BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_D18 (651 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4A8.15c |cdc3||profilin|Schizosaccharomyces pombe|chr 1|||Ma... 94 2e-20 SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Sc... 25 7.2 >SPAC4A8.15c |cdc3||profilin|Schizosaccharomyces pombe|chr 1|||Manual Length = 127 Score = 93.9 bits (223), Expect = 2e-20 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 1/127 (0%) Frame = +2 Query: 92 MSWQDYVDKQLMASXCVTKAAIAGHDGN-VWAKSEGFEISKDEVAKIVAGFXNESLLTXG 268 MSWQ YVD L+ + + +AAI G+ VWA S GF +S E+ + AGF + + Sbjct: 1 MSWQAYVDTSLLGTGKIDRAAIVSRAGDSVWAASAGFNLSPQEIQGLAAGFQDPPSMFGT 60 Query: 269 GVTIAGTRYIYLSGTDHIIRAKLGKVGVHCMXTQQAVVISLYEEPIQPQQAASVVXKLGQ 448 G+ +AG +YI + I KL K G+ C+ T+ +++S Y E P +AA + L Sbjct: 61 GIILAGQKYITIRAEGRSIYGKLQKEGIICVATKLCILVSHYPETTLPGEAAKITEALAD 120 Query: 449 YLITCGY 469 YL+ GY Sbjct: 121 YLVGVGY 127 >SPCC962.02c |bir1|cut17, pbh1, SPCP31B10.10c|survivin homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 997 Score = 25.4 bits (53), Expect = 7.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +3 Query: 174 MCGQSRKASKFQKMKWRR 227 MC S++ FQK KW R Sbjct: 19 MCNYSKRLDTFQKKKWPR 36 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,423,949 Number of Sequences: 5004 Number of extensions: 44340 Number of successful extensions: 79 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 78 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 293780908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -