BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_D18 (651 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. 215 3e-58 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 22 5.9 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 7.8 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 21 7.8 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 21 7.8 >AY545000-1|AAS50159.2| 126|Apis mellifera profilin protein. Length = 126 Score = 215 bits (525), Expect = 3e-58 Identities = 97/126 (76%), Positives = 111/126 (88%) Frame = +2 Query: 92 MSWQDYVDKQLMASXCVTKAAIAGHDGNVWAKSEGFEISKDEVAKIVAGFXNESLLTXGG 271 MS QDYVDKQL+AS CVTKAAIAGHDGN+WAKSEGFE+SK+E+ K+V GF + +LT G Sbjct: 1 MSCQDYVDKQLLASRCVTKAAIAGHDGNLWAKSEGFEVSKEELTKLVQGFEEQDILTSSG 60 Query: 272 VTIAGTRYIYLSGTDHIIRAKLGKVGVHCMXTQQAVVISLYEEPIQPQQAASVVXKLGQY 451 VT+AG RYIYLSGTD +IRAKLGKVGVHCM T QAVV+SLYE+PIQPQQAASVV KLG Y Sbjct: 61 VTLAGNRYIYLSGTDRVIRAKLGKVGVHCMKTTQAVVVSLYEDPIQPQQAASVVEKLGDY 120 Query: 452 LITCGY 469 L++CGY Sbjct: 121 LVSCGY 126 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -3 Query: 409 LDGFFIERNDHSLLCXH 359 + G IER DH++LC + Sbjct: 327 ISGAPIERPDHAVLCVY 343 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/39 (25%), Positives = 15/39 (38%) Frame = -2 Query: 263 SLAVIHXQSQPQSSPLHLLKFRSLPTLPTHCHHDRQWQL 147 SL +H + K LP HHD +W++ Sbjct: 483 SLLFVHDTKNAGIWMIDFAKTLPLPQHLPRIHHDAEWKV 521 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/39 (25%), Positives = 15/39 (38%) Frame = -2 Query: 263 SLAVIHXQSQPQSSPLHLLKFRSLPTLPTHCHHDRQWQL 147 SL +H + K LP HHD +W++ Sbjct: 398 SLLFVHDTKNAGIWMIDFAKTLPLPQHLPRIHHDAEWKV 436 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.4 bits (43), Expect = 7.8 Identities = 10/39 (25%), Positives = 15/39 (38%) Frame = -2 Query: 263 SLAVIHXQSQPQSSPLHLLKFRSLPTLPTHCHHDRQWQL 147 SL +H + K LP HHD +W++ Sbjct: 717 SLLFVHDTKNAGIWMIDFAKTLPLPQHLPRIHHDAEWKV 755 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,870 Number of Sequences: 438 Number of extensions: 2943 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -