BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_D17 (603 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) 167 6e-42 SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) 29 2.9 SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) 29 3.8 SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) 28 6.7 SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) 27 8.8 >SB_19131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 167 bits (406), Expect = 6e-42 Identities = 76/121 (62%), Positives = 88/121 (72%) Frame = +1 Query: 100 PCYKMRIFSPDPIVAKSRFWYFLRQLKKFKKTTGXXXXXXXXXXXXXXXXXNFGIWLRYE 279 P YKMRIF+PD +VA+S+FWYF+ QLK+ KK+ G NFGIWLRY+ Sbjct: 226 PLYKMRIFAPDDVVARSKFWYFISQLKRMKKSQGEIVSCQQIYEKKPLQIKNFGIWLRYD 285 Query: 280 SRSGVHNMYREYRDLSVXGAVTQCYRDMGAXHRARAHSIQIIKVEVIXAAACRRPQVKQF 459 SRSG HNMYREYRDL+V GAVT CYRDM A HRAR +SIQI+KVEVI A+ RRP VKQ Sbjct: 286 SRSGTHNMYREYRDLTVSGAVTACYRDMAARHRARGYSIQIMKVEVIPASKARRPHVKQM 345 Query: 460 H 462 H Sbjct: 346 H 346 >SB_59712| Best HMM Match : SAP (HMM E-Value=3e-13) Length = 1072 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/47 (31%), Positives = 20/47 (42%) Frame = +3 Query: 342 HSVLQRYGSXTQSPSSFNTDYQSGSNQXCCVSPSTGQTVPQQHHQIP 482 H + Q+ QSPS+ N + Q PQQHHQ+P Sbjct: 302 HHLPQQQPQQLQSPSNHNAQPMTTQAAAFFQQVPEQQQSPQQHHQLP 348 >SB_21597| Best HMM Match : ig (HMM E-Value=2.9e-14) Length = 1931 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 494 VCTTTRDLIPSRTRGLXLTSCNCNVRHITIKPM*KW 601 +C T I SRTRGL ++CN V + + P KW Sbjct: 820 LCDTCAFNITSRTRGLCPSTCNKTV-SVRVDPSGKW 854 >SB_49314| Best HMM Match : 7tm_1 (HMM E-Value=5.4e-30) Length = 300 Score = 27.9 bits (59), Expect = 6.7 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 391 SIQIIKVEVIXAAACRRPQVKQFHNSTIRFPLPKRVHHYKRLNT 522 S++I ++ AC P V HN +R + + VHH KR+ T Sbjct: 246 SLEITCFFLLHVNACCNPVVYSLHNPKLRKCMNRLVHH-KRVRT 288 >SB_44112| Best HMM Match : PA14 (HMM E-Value=5e-05) Length = 1433 Score = 27.5 bits (58), Expect = 8.8 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 154 NEIWRQLDPERKFSFYSKGGLGSFSDGSL--RPITSYSLNCPL 32 +E+WR E ++ GLG GSL P T+ SL C L Sbjct: 971 SEVWRVAPQEAWVRVATRSGLGPKKSGSLAKEPSTAPSLPCDL 1013 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,258,717 Number of Sequences: 59808 Number of extensions: 358694 Number of successful extensions: 979 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 904 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 978 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1463691625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -