BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_D12 (527 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_31829| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) 31 0.78 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 29 2.4 SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) 28 4.1 SB_47092| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_28918| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_45684| Best HMM Match : T-box (HMM E-Value=1.5e-32) 27 9.6 SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) 27 9.6 >SB_31829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 40.7 bits (91), Expect = 7e-04 Identities = 22/71 (30%), Positives = 32/71 (45%) Frame = +2 Query: 182 TPFSQLKLNEIGSWFGRRSKTPSAVAGAFSRAWWRWQHKYVQPKKVGMAPFYQLLVGSMV 361 T F + KL G + R + + G SR W ++ KYV K M PF+ + + Sbjct: 2 TSFGETKLKNAGDYVVRNASLENMWRG-MSRVWNSYRAKYVTCKNARMTPFWHAVFVAAA 60 Query: 362 FFYAINYGRIK 394 YAI Y +K Sbjct: 61 LNYAIEYNHLK 71 >SB_6866| Best HMM Match : Peptidase_C48 (HMM E-Value=0.045) Length = 1050 Score = 30.7 bits (66), Expect = 0.78 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +2 Query: 218 SWFGRRSKTPSAVAGAFSRAWWRWQHKYV 304 SW RRS S FS +WRW H++V Sbjct: 489 SW-SRRSAATSLDTKTFSIEYWRWHHRFV 516 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 29.1 bits (62), Expect = 2.4 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +2 Query: 230 RRSKTPSAVAGAFSRAWWRWQHKYVQPKKVGMAPFY 337 RRS S FS +WRW H++ + FY Sbjct: 785 RRSAATSLDTKTFSIEYWRWHHRFYSGSTATIRIFY 820 >SB_16501| Best HMM Match : Fork_head (HMM E-Value=3.3e-29) Length = 594 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +2 Query: 179 DTPFSQLKLNEIGSWFGR 232 D+P +QL LNEI SWF R Sbjct: 423 DSPDTQLTLNEIYSWFTR 440 >SB_47092| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 27.5 bits (58), Expect = 7.2 Identities = 17/59 (28%), Positives = 25/59 (42%) Frame = -2 Query: 289 PSPPGSTESSGHGRRSLAAATEPRTDFVQLQLTEWSIRFSIVACRIVRPMYSRIILPWG 113 P+PP S HG + A E R Q +LT W I + +Y+ ++ P G Sbjct: 462 PAPPSSKT---HGNFTEKVAHEHRQQNYQAELTRWQNTLDIHTKATLERIYNVLLFPDG 517 >SB_28918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/31 (41%), Positives = 16/31 (51%) Frame = +2 Query: 332 FYQLLVGSMVFFYAINYGRIKHHKNYKYH*R 424 F+ L M FFY Y +I+HHK H R Sbjct: 184 FFVLPFALMCFFYLKIYLKIRHHKKQTAHMR 214 >SB_45684| Best HMM Match : T-box (HMM E-Value=1.5e-32) Length = 337 Score = 27.1 bits (57), Expect = 9.6 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 146 PYDPARYYGKPDTPFSQLKLNEIGSWFGRRSKTPSAVAGAFSRAWW 283 P P R Y PD+PF+ +L S R+S +P+ + +W Sbjct: 259 PPAPVRLYMHPDSPFTGEQLLNRSS-RSRKSSSPTTTQTTMATIYW 303 >SB_8350| Best HMM Match : ShTK (HMM E-Value=2.5e-09) Length = 1103 Score = 27.1 bits (57), Expect = 9.6 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +2 Query: 119 RQYNPAVHGPYDPARYYGKP 178 R + PAVH PY P Y P Sbjct: 282 RPFPPAVHAPYHPPPAYSNP 301 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,628,066 Number of Sequences: 59808 Number of extensions: 335503 Number of successful extensions: 719 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 634 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 718 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1197191618 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -