BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_D11 (411 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 24 2.5 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 3.3 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 23.8 bits (49), Expect = 2.5 Identities = 12/41 (29%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 155 FCRYCNSCFAGKECTEQVQSGIRNSQASIKFYS-XASYENL 274 F YC + F + E V +G+ + Q + FY+ S+E++ Sbjct: 408 FGDYCITDFQAYDTDEDVINGVPDHQLTFGFYNYPVSFESM 448 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 3.3 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -2 Query: 140 YEPPSXRIYAILMIRTKAPASMTLVNFDTYAGA 42 Y+P R AI ++R AP + + + T+A A Sbjct: 1220 YKPNISREEAIALLRNAAPGTFIVRDSTTFANA 1252 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 409,347 Number of Sequences: 2352 Number of extensions: 6965 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33349914 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -