BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_D11 (411 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC038587-1|AAH38587.1| 553|Homo sapiens EGF-like-domain, multip... 29 4.5 AY358333-1|AAQ88699.1| 338|Homo sapiens EGFL6 protein. 29 4.5 AK075214-1|BAC11477.1| 553|Homo sapiens protein ( Homo sapiens ... 29 4.5 AJ245671-1|CAB92132.1| 554|Homo sapiens hypothetical protein pr... 29 4.5 AF193055-1|AAG22483.1| 474|Homo sapiens unknown protein. 29 4.5 AF186084-1|AAF27812.1| 553|Homo sapiens epidermal growth factor... 29 4.5 >BC038587-1|AAH38587.1| 553|Homo sapiens EGF-like-domain, multiple 6 protein. Length = 553 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/61 (21%), Positives = 26/61 (42%) Frame = +3 Query: 54 CIKVHECHTRRCLCPYH*YCINPXTWWFIFLKMASVATVTRALLGKNVLNKCKVVSATAK 233 C+ + EC + + +CPY+ C+N ++ + +N+C + S T Sbjct: 172 CLDIDECASGKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCS 231 Query: 234 H 236 H Sbjct: 232 H 232 >AY358333-1|AAQ88699.1| 338|Homo sapiens EGFL6 protein. Length = 338 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/61 (21%), Positives = 26/61 (42%) Frame = +3 Query: 54 CIKVHECHTRRCLCPYH*YCINPXTWWFIFLKMASVATVTRALLGKNVLNKCKVVSATAK 233 C+ + EC + + +CPY+ C+N ++ + +N+C + S T Sbjct: 172 CLDIDECASGKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCS 231 Query: 234 H 236 H Sbjct: 232 H 232 >AK075214-1|BAC11477.1| 553|Homo sapiens protein ( Homo sapiens cDNA FLJ90733 fis, clone PLACE1010251, highly similar to Epidermal growth factor-like protein 6 precursor. ). Length = 553 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/61 (21%), Positives = 26/61 (42%) Frame = +3 Query: 54 CIKVHECHTRRCLCPYH*YCINPXTWWFIFLKMASVATVTRALLGKNVLNKCKVVSATAK 233 C+ + EC + + +CPY+ C+N ++ + +N+C + S T Sbjct: 172 CLDIDECASGKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCS 231 Query: 234 H 236 H Sbjct: 232 H 232 >AJ245671-1|CAB92132.1| 554|Homo sapiens hypothetical protein protein. Length = 554 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/61 (21%), Positives = 26/61 (42%) Frame = +3 Query: 54 CIKVHECHTRRCLCPYH*YCINPXTWWFIFLKMASVATVTRALLGKNVLNKCKVVSATAK 233 C+ + EC + + +CPY+ C+N ++ + +N+C + S T Sbjct: 172 CLDIDECASGKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCS 231 Query: 234 H 236 H Sbjct: 232 H 232 >AF193055-1|AAG22483.1| 474|Homo sapiens unknown protein. Length = 474 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/61 (21%), Positives = 26/61 (42%) Frame = +3 Query: 54 CIKVHECHTRRCLCPYH*YCINPXTWWFIFLKMASVATVTRALLGKNVLNKCKVVSATAK 233 C+ + EC + + +CPY+ C+N ++ + +N+C + S T Sbjct: 93 CLDIDECASGKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCS 152 Query: 234 H 236 H Sbjct: 153 H 153 >AF186084-1|AAF27812.1| 553|Homo sapiens epidermal growth factor repeat containing protein protein. Length = 553 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/61 (21%), Positives = 26/61 (42%) Frame = +3 Query: 54 CIKVHECHTRRCLCPYH*YCINPXTWWFIFLKMASVATVTRALLGKNVLNKCKVVSATAK 233 C+ + EC + + +CPY+ C+N ++ + +N+C + S T Sbjct: 172 CLDIDECASGKVICPYNRRCVNTFGSYYCKCHIGFELQYISGRYDCIDINECTMDSHTCS 231 Query: 234 H 236 H Sbjct: 232 H 232 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,636,171 Number of Sequences: 237096 Number of extensions: 1044606 Number of successful extensions: 1830 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1830 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3030544982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -