BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_C18 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g19600.1 68418.m02333 sulfate transporter, putative similar t... 28 6.2 >At5g19600.1 68418.m02333 sulfate transporter, putative similar to sulfate transporter [Arabidopsis thaliana] GI:2285885; contains Pfam profiles PF00916: Sulfate transporter family, PF01740: STAS domain; supporting cDNA gi|14141683|dbj|AB061739.1| Length = 634 Score = 27.9 bits (59), Expect = 6.2 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -1 Query: 313 RGFFTLFKGVCFGVTFPPNRKKPCFYKLTRLIRKTKLNFLQRXIFE 176 RGF + FK C FP + KP + RL++ KL IFE Sbjct: 23 RGFGSKFKSKCKETFFPDDPFKPISQEPNRLLKTKKLLEYFVPIFE 68 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,791,970 Number of Sequences: 28952 Number of extensions: 169469 Number of successful extensions: 232 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 228 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 232 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -