BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_C10 (654 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4Z0Q1 Cluster: Putative uncharacterized protein; n=1; ... 35 2.0 UniRef50_UPI0000E48997 Cluster: PREDICTED: similar to reverse tr... 33 7.9 >UniRef50_Q4Z0Q1 Cluster: Putative uncharacterized protein; n=1; Plasmodium berghei|Rep: Putative uncharacterized protein - Plasmodium berghei Length = 89 Score = 34.7 bits (76), Expect = 2.0 Identities = 19/57 (33%), Positives = 31/57 (54%), Gaps = 2/57 (3%) Frame = +3 Query: 420 RFSRFKYIVSLQI-IHNIIWQVIHVDCLCILIVFLFQIATFXNHYATR-CLYILYQY 584 RF+ F + + IH +I+ ++HV LCILI F+ + +Y T CL+ + Y Sbjct: 27 RFTFFIFFFKCHVFIHTVIF-IVHVTMLCILIDFIITLYVDLKNYKTPICLFYFFFY 82 >UniRef50_UPI0000E48997 Cluster: PREDICTED: similar to reverse transcriptase-like; n=6; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to reverse transcriptase-like - Strongylocentrotus purpuratus Length = 415 Score = 32.7 bits (71), Expect = 7.9 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +2 Query: 5 RRGRLPTRWTDIIKEATNTSVPGAIKQAECRQHWRKLVQK 124 +RGR +W D IKE T + A + A+ R +WRK ++ Sbjct: 360 KRGRQRKQWFDNIKEWTGLTYTEAKRLAQDRNNWRKTTRR 399 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 611,815,931 Number of Sequences: 1657284 Number of extensions: 11457063 Number of successful extensions: 26920 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26908 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49173558301 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -