BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_C10 (654 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51269-1|AAC51202.1| 962|Homo sapiens armadillo repeat protein ... 31 3.6 BC036893-1|AAH36893.1| 377|Homo sapiens ARVCF protein protein. 31 3.6 BC107127-1|AAI07128.1| 431|Homo sapiens astacin-like metallo-en... 30 8.3 BC107126-1|AAI07127.1| 430|Homo sapiens ASTL protein protein. 30 8.3 AJ537600-1|CAD61265.2| 431|Homo sapiens oocyte astacin protein. 30 8.3 >U51269-1|AAC51202.1| 962|Homo sapiens armadillo repeat protein protein. Length = 962 Score = 31.1 bits (67), Expect = 3.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 9 EEDCQPGGRTLSRRPQTPASRAPLSRPNAGSIG 107 E+ GG RP P APL++P GS+G Sbjct: 302 EDTADDGGELADERPAFPMVTAPLAQPERGSMG 334 >BC036893-1|AAH36893.1| 377|Homo sapiens ARVCF protein protein. Length = 377 Score = 31.1 bits (67), Expect = 3.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 9 EEDCQPGGRTLSRRPQTPASRAPLSRPNAGSIG 107 E+ GG RP P APL++P GS+G Sbjct: 302 EDTADDGGELADERPAFPMVTAPLAQPERGSMG 334 >BC107127-1|AAI07128.1| 431|Homo sapiens astacin-like metallo-endopeptidase (M12 family) protein. Length = 431 Score = 29.9 bits (64), Expect = 8.3 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = +3 Query: 42 SRRPQTPASRAPLSRPNAGSIGGSWCKNWTKVVTT 146 +R+PQT AS +P SRP AG+ G + ++W V+T Sbjct: 360 ARQPQTLAS-SPRSRPGAGAPGVAQEQSWLAGVST 393 >BC107126-1|AAI07127.1| 430|Homo sapiens ASTL protein protein. Length = 430 Score = 29.9 bits (64), Expect = 8.3 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = +3 Query: 42 SRRPQTPASRAPLSRPNAGSIGGSWCKNWTKVVTT 146 +R+PQT AS +P SRP AG+ G + ++W V+T Sbjct: 359 ARQPQTLAS-SPRSRPGAGAPGVAQEQSWLAGVST 392 >AJ537600-1|CAD61265.2| 431|Homo sapiens oocyte astacin protein. Length = 431 Score = 29.9 bits (64), Expect = 8.3 Identities = 16/35 (45%), Positives = 24/35 (68%) Frame = +3 Query: 42 SRRPQTPASRAPLSRPNAGSIGGSWCKNWTKVVTT 146 +R+PQT AS +P SRP AG+ G + ++W V+T Sbjct: 360 ARQPQTLAS-SPRSRPGAGAPGVAQEQSWLAGVST 393 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 91,042,411 Number of Sequences: 237096 Number of extensions: 1766930 Number of successful extensions: 3105 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2993 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3105 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7310122300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -