BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_C05 (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 6.5 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 21 8.6 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 6.5 Identities = 8/32 (25%), Positives = 19/32 (59%) Frame = -2 Query: 111 REKQFEKNITQVFPSRARLHSLLKYVLPRVEV 16 R Q + N+ + SRA ++ ++ V+P +++ Sbjct: 61 RASQVKLNVFSIIKSRAAGNNNIQRVVPEIKI 92 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +3 Query: 186 NNFHYAGTTFHANMSAGFHGLLSRGDL 266 N+ H+AG HA H + + G L Sbjct: 321 NHHHHAGHHIHAQHHVVNHHVAANGSL 347 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,378 Number of Sequences: 336 Number of extensions: 2658 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -