BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_C05 (643 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces ... 28 1.3 SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosacch... 27 1.7 SPAC4G8.11c |atp10||F1-F0 ATPase assembly protein|Schizosaccharo... 26 4.0 >SPCC962.01 ||SPCP31B10.09|C2 domain protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1429 Score = 27.9 bits (59), Expect = 1.3 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -1 Query: 583 AWPRSRLWFGWRGTFFILITG 521 +W S+LWF + FFI+ITG Sbjct: 215 SWIASKLWFRFFILFFIIITG 235 >SPBC16D10.05 |mok13||alpha-1,3-glucan synthase Mok13|Schizosaccharomyces pombe|chr 2|||Manual Length = 2358 Score = 27.5 bits (58), Expect = 1.7 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +2 Query: 344 FNEMFKMNPTQHPIVFLKDVSHSALRDLLQFMYQGEVNVKQEELASFISTAEQLQ 508 +NE + T +F +D S DL ++NV+ + L+SF+ ++E L+ Sbjct: 1703 YNEFYSQLDTSTSDIF-QDTSVDGFPDL---QVSSDINVRNDRLSSFVMSSEDLR 1753 >SPAC4G8.11c |atp10||F1-F0 ATPase assembly protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 267 Score = 26.2 bits (55), Expect = 4.0 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = +2 Query: 200 CWNNFPRKYVSGLSWPAVAWRSR 268 CWN + Y + S+P + W ++ Sbjct: 202 CWNEYITAYDNKFSFPEIGWNNK 224 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,343,426 Number of Sequences: 5004 Number of extensions: 43119 Number of successful extensions: 102 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -