BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_C02 (433 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. 24 2.7 AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 23 4.6 >AJ535205-1|CAD59405.1| 1201|Anopheles gambiae SMC3 protein protein. Length = 1201 Score = 23.8 bits (49), Expect = 2.7 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +1 Query: 100 QVASEAAYKISYFNSTRSRL 159 QV+S+ + YFN++RSRL Sbjct: 658 QVSSKGSLTGGYFNTSRSRL 677 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 23.0 bits (47), Expect = 4.6 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = +1 Query: 298 LLSEQPFAYVLSSKEQGNRCDNCLQKVKLLKCS 396 LL++Q + + +EQG + N ++ VK ++CS Sbjct: 131 LLADQGLSAL--KREQGQKLANKIRAVKYMECS 161 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 399,804 Number of Sequences: 2352 Number of extensions: 6987 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35717724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -