BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B23 (593 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 23 1.9 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 21 5.9 AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like prote... 21 7.8 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 7.8 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/48 (18%), Positives = 23/48 (47%) Frame = +2 Query: 296 YRESVCSSRLFSNSWSFIHGSLEFXNWKDKTLSXNDESENSCTRAYHC 439 + E+ +++ + S + +HG ++ N+ + L+ + T HC Sbjct: 1147 FDENTKDTKITAASETILHGLKKYTNYSMEVLAYTSGGDGVRTTPIHC 1194 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/21 (38%), Positives = 12/21 (57%) Frame = -2 Query: 154 IH*IVTACVTI*FCTEIILLC 92 +H + C+ +C IILLC Sbjct: 277 MHLLFLLCIYYFYCALIILLC 297 >AJ969955-1|CAI94742.1| 160|Tribolium castaneum torso-like protein protein. Length = 160 Score = 21.0 bits (42), Expect = 7.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 129 LQSSFVLKLYCYVKI 85 + SSFV K +CYV + Sbjct: 30 INSSFVHKEHCYVLV 44 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.0 bits (42), Expect = 7.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 218 TLGATAQGNGSISPCXNDKRKISXKIYRES 307 TLG G G SP +R + K YR S Sbjct: 106 TLGRGDLGGGDTSPNSALQRARADKTYRRS 135 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,093 Number of Sequences: 336 Number of extensions: 2317 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14935063 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -