BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B23 (593 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68220-3|CAA92488.1| 144|Caenorhabditis elegans Hypothetical pr... 47 9e-06 AF077532-1|AAC26268.1| 301|Caenorhabditis elegans Hypothetical ... 28 5.8 >Z68220-3|CAA92488.1| 144|Caenorhabditis elegans Hypothetical protein T20D3.6 protein. Length = 144 Score = 47.2 bits (107), Expect = 9e-06 Identities = 26/58 (44%), Positives = 34/58 (58%) Frame = +3 Query: 291 KFTENPFVPLGCLATAGALSMGLWSFXTGKTRLSXQMMRVRILAQGLTIAALVIGVVI 464 K NP VPLG LAT G L + + +R + MR R++AQG T+AALV G V+ Sbjct: 51 KALNNPLVPLGMLATTGCLIGMMVATLRRSSRGAQYFMRGRVVAQGFTVAALVGGAVM 108 >AF077532-1|AAC26268.1| 301|Caenorhabditis elegans Hypothetical protein F40B1.1 protein. Length = 301 Score = 27.9 bits (59), Expect = 5.8 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +2 Query: 284 SXKIYRESVCSSRLFSNSWSFIHGSLEFXNW 376 S K YRE + FSN+ S+ +G+ EF +W Sbjct: 79 SGKAYREDDNFNFQFSNAHSYGNGTTEFISW 109 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,356,950 Number of Sequences: 27780 Number of extensions: 203590 Number of successful extensions: 412 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 406 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1258229602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -