BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B23 (593 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. 25 0.74 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 3.9 >AF134816-1|AAD40232.1| 50|Apis mellifera unknown protein. Length = 50 Score = 24.6 bits (51), Expect = 0.74 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 178 KRRKCQLNQNQRIYIGCNCARK 243 KRRK LNQNQ + +C+ K Sbjct: 9 KRRKKNLNQNQMMIWALDCSIK 30 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 22.2 bits (45), Expect = 3.9 Identities = 8/41 (19%), Positives = 21/41 (51%) Frame = +2 Query: 317 SRLFSNSWSFIHGSLEFXNWKDKTLSXNDESENSCTRAYHC 439 +++ S+S + +HG ++ N+ + L+ + + HC Sbjct: 1133 TKITSSSETILHGLKKYTNYSMQVLAFTSGGDGVKSAPIHC 1173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,741 Number of Sequences: 438 Number of extensions: 2680 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -