BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B15 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_02_0154 - 5923251-5923604,5924167-5925567,5925639-5925986 29 2.4 04_04_0706 + 27419215-27419371,27419521-27419734,27419818-274199... 29 4.2 >10_02_0154 - 5923251-5923604,5924167-5925567,5925639-5925986 Length = 700 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 466 MIQPASRHCLKMTHVIKLNNGSNFVTYNIILWH 564 M+ A+ HC + +H +L+NG F+T +L H Sbjct: 635 MLLYAANHCSQESHARQLSNGCEFITIVSLLAH 667 >04_04_0706 + 27419215-27419371,27419521-27419734,27419818-27419913, 27420006-27420123,27420211-27420384,27420633-27420803, 27420932-27420987,27421125-27421214,27421296-27421444, 27421640-27421722,27421830-27421958,27422063-27422137, 27422248-27422416,27422965-27423104,27423191-27423298, 27423603-27423783,27424445-27424542,27424639-27424728, 27424881-27425034,27425376-27425431,27425483-27425533, 27425651-27425732,27425821-27425995,27426748-27426823, 27426951-27427121,27427198-27427269,27427350-27427454, 27427948-27428037,27428703-27428908,27428989-27429190, 27429294-27429473,27429858-27429925,27430005-27430341, 27430428-27430637,27430765-27431448,27431537-27431940, 27432495-27432542,27432777-27433023,27433381-27433602, 27433796-27434026 Length = 2122 Score = 28.7 bits (61), Expect = 4.2 Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 1/66 (1%) Frame = +3 Query: 189 FRRQNECNGVRGMELIATPRLIVLII*RTVLQ-TCLLSVVYGRVI*MLASYWLLFLPFQF 365 F+ ++ GV+ + L VL + + V+Q TCLL ++ + +L+ W+L + Q+ Sbjct: 1147 FKNFDDLFGVKPTASVLVSLLDVLFLKKDVIQRTCLLQPLFQLLSKLLSDQWILGIVCQY 1206 Query: 366 HNFGFD 383 N G D Sbjct: 1207 -NKGHD 1211 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,577,373 Number of Sequences: 37544 Number of extensions: 254012 Number of successful extensions: 429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 429 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -