BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B15 (652 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19048| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_19153| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.3 >SB_19048| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 611 Score = 29.9 bits (64), Expect = 1.9 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = +1 Query: 463 AMIQPASRHCLKMTHVIKLNNGSNFVTYNIILWHV 567 A + SRH LK++ + K + ++ +N++ WHV Sbjct: 276 AFMIDTSRHYLKLSIIKKFLDAMSYAKFNVLHWHV 310 >SB_19153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 209 Score = 28.7 bits (61), Expect = 4.3 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 275 CASNNQYYQAWGCD*FHTPYAITFILTTK 189 C SN Y WGC + Y + ++T K Sbjct: 102 CVSNTAYNSRWGCHHYWKNYPLDVVITDK 130 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,605,963 Number of Sequences: 59808 Number of extensions: 323107 Number of successful extensions: 523 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 522 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1657237625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -