BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B15 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g37430.1 68418.m04503 hypothetical protein contains Pfam PF04... 28 4.7 At3g45470.1 68416.m04910 zinc finger protein-related contains lo... 27 8.2 >At5g37430.1 68418.m04503 hypothetical protein contains Pfam PF04510 : Family of unknown function (DUF577)); common family comprised of At5g37410, At5g37400, At5g37920, At5g37460, At5g37650, At5g37470, At5g37420, At5g37430 Length = 607 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = -2 Query: 444 NIYRVNKKANYKQRNFWTSINQIQNYGTETVERATNMTLTFKLRAH 307 N+Y+ ++ Y F + I +++ GT+T E T + + F + H Sbjct: 269 NLYKYSELHCYFVSKFVSKIGKVRGVGTQTKELVTKINMLFTKQYH 314 >At3g45470.1 68416.m04910 zinc finger protein-related contains low similarity to Swiss-Prot:O76924 ariadne-2 protein (Ari-2) [Drosophila melanogaster] Length = 222 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 484 RHCLKMTHVIKLNNGSNFVT 543 R C+K H+I+LN G N +T Sbjct: 165 RQCVKCRHLIELNQGCNHMT 184 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,235,840 Number of Sequences: 28952 Number of extensions: 223978 Number of successful extensions: 421 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 419 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 420 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -