BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B13 (445 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1A6.04c |plb1||phospholipase B homolog Plb1|Schizosaccharomy... 27 1.3 SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosacch... 25 4.0 >SPAC1A6.04c |plb1||phospholipase B homolog Plb1|Schizosaccharomyces pombe|chr 1|||Manual Length = 613 Score = 27.1 bits (57), Expect = 1.3 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = -1 Query: 208 VTNWSRFGFLLFSGSRYFGR----FNRVXT-FGRDXXNWLNGNY 92 V N+ FGF++ + S YF + FN T GR +L GN+ Sbjct: 323 VINYDNFGFMMGASSTYFNKIMRNFNDSSTKNGRIIQQYLKGNF 366 >SPBP19A11.04c |mor2|cps12|morphogenesis protein Mor2|Schizosaccharomyces pombe|chr 2|||Manual Length = 2196 Score = 25.4 bits (53), Expect = 4.0 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 223 SGYLVVTNWSRFGFLLFSGSRY 158 S Y + NW F FL+ S SR+ Sbjct: 180 SSYFSLANWESFAFLVGSMSRF 201 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,388,543 Number of Sequences: 5004 Number of extensions: 20656 Number of successful extensions: 55 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 53 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 162176800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -