BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B13 (445 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 27 0.40 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 26 0.69 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 26.6 bits (56), Expect = 0.40 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 265 GVXWGYIVLFGLWYSGYLVVTNWSRFGFLLFSGS 164 GV +I G+ + +++VT+ + GF L+SGS Sbjct: 2812 GVHKAFIGYTGISRTAFVIVTSGATGGFFLYSGS 2845 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 25.8 bits (54), Expect = 0.69 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -1 Query: 268 IGVXWGYIVLF-GLWYSGYLVVTNWSRFGFLLFSGSR 161 IG ++ F G+ +G++V+T + G+LL+ GS+ Sbjct: 2809 IGTIHQTVISFTGISRAGFIVLTTGATGGYLLYKGSK 2845 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 337,095 Number of Sequences: 2352 Number of extensions: 5080 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 37418568 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -