BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B12 (656 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC365.06 |pmt3|ubl2, smt3|SUMO|Schizosaccharomyces pombe|chr 2... 84 1e-17 SPAC9E9.08 |rad26||ATRIP|Schizosaccharomyces pombe|chr 1|||Manual 27 3.1 SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pom... 27 3.1 SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 26 5.5 SPCC1919.10c |myo52||myosin type V|Schizosaccharomyces pombe|chr... 26 5.5 SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ... 26 5.5 SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosa... 25 9.6 SPBC13G1.15c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual 25 9.6 SPCC1620.09c |tfg1||transcription factor TFIIF complex alpha sub... 25 9.6 >SPBC365.06 |pmt3|ubl2, smt3|SUMO|Schizosaccharomyces pombe|chr 2|||Manual Length = 117 Score = 84.2 bits (199), Expect = 1e-17 Identities = 43/82 (52%), Positives = 48/82 (58%) Frame = +1 Query: 136 KGENEHINLKVLXQDNAIVQFKIKKHTPLRKLMNAYCDRAGLSMQVVRFXFDGQPINXND 315 K EHINLKV+ QDN V FKIKK T KLM YC R G SM +RF DG+ I + Sbjct: 30 KPSTEHINLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQ 89 Query: 316 TPTSLXMEXGDTIXVYQQQTGG 381 TP L ME GD I +Q GG Sbjct: 90 TPAELDMEDGDQIEAVLEQLGG 111 >SPAC9E9.08 |rad26||ATRIP|Schizosaccharomyces pombe|chr 1|||Manual Length = 614 Score = 26.6 bits (56), Expect = 3.1 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 80 SFVLIVSRTTLISKWLMKRREKTNTLI*KYXVKITQLY 193 +F+ + +LIS +L+K EK+N L K+ V I LY Sbjct: 341 TFIFQENVVSLISGFLLKEYEKSNFLDSKFYVLIDFLY 378 >SPAC821.13c ||SPAC955.01c|P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1562 Score = 26.6 bits (56), Expect = 3.1 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 442 LILTHWRWSILKIIKFTLGTLLR 374 L+ H RWS +++ K+ LGT + Sbjct: 1285 LLFCHGRWSYVRLSKYILGTFYK 1307 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 25.8 bits (54), Expect = 5.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 234 HQFPERCVFLYFELYNCV 181 H+FP C+F F YNC+ Sbjct: 533 HRFP--CIFTSFSCYNCI 548 >SPCC1919.10c |myo52||myosin type V|Schizosaccharomyces pombe|chr 3|||Manual Length = 1516 Score = 25.8 bits (54), Expect = 5.5 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -3 Query: 201 FELYNCVILT*YFQINVFVFSLLFI 127 +E+YN +I + Y INV F+ LFI Sbjct: 1307 YEIYNALIRSIYRFINVEAFNSLFI 1331 >SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion cytochrome c oxidase assembly protein Cox1102, mitochondrial ribosomal protein Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 25.8 bits (54), Expect = 5.5 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 234 HQFPERCVFLYFELYNCV 181 H+FP C+F F YNC+ Sbjct: 533 HRFP--CIFTSFSCYNCI 548 >SPAC2G11.13 |atg22||autophagy associated protein Atg22 |Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 25.0 bits (52), Expect = 9.6 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 71 SIHSFVLIVSRTTLISKWLMKRREKTNTL 157 +++ FV++V L S W+M + KT L Sbjct: 496 AVYIFVIVVMTLPLSSLWIMYQHSKTPNL 524 >SPBC13G1.15c |||dubious|Schizosaccharomyces pombe|chr 2|||Manual Length = 111 Score = 25.0 bits (52), Expect = 9.6 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 604 LIIYLTTSYLRRIMLCVARLCYYVSQNYF 518 L+I + T Y RRI+ C A LC + Y+ Sbjct: 39 LLIVVITLY-RRIVECCASLCSLIFSKYY 66 >SPCC1620.09c |tfg1||transcription factor TFIIF complex alpha subunit Tfg1|Schizosaccharomyces pombe|chr 3|||Manual Length = 490 Score = 25.0 bits (52), Expect = 9.6 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = +2 Query: 32 YAFVCENRYQISLSIHSFVLIVSRTTLISKWLMKRREKTN 151 Y F N +Q +LSI +++ T I +W MK+ + N Sbjct: 193 YRFNQRNNFQ-TLSIDEAEAKMNKKTPIPRWFMKKESEEN 231 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,377,179 Number of Sequences: 5004 Number of extensions: 41628 Number of successful extensions: 73 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 73 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 297805304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -