BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_B12 (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41074| Best HMM Match : ubiquitin (HMM E-Value=2.3e-10) 35 0.067 SB_1049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.9 SB_35774| Best HMM Match : DSPc (HMM E-Value=1e-26) 29 3.3 SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) 28 7.7 >SB_41074| Best HMM Match : ubiquitin (HMM E-Value=2.3e-10) Length = 333 Score = 34.7 bits (76), Expect = 0.067 Identities = 23/87 (26%), Positives = 41/87 (47%), Gaps = 2/87 (2%) Frame = +1 Query: 127 DEKKGENEHINLKVLXQDNAIVQFKIKKHT--PLRKLMNAYCDRAGLSMQVVRFXFDGQP 300 D++ N HI + L + ++ FK KHT ++ L+ A + G R F+GQ Sbjct: 64 DDQIVSNPHIAVLTLTGERILIPFKSPKHTIIEVKYLIEA---KGGYPKDQQRLVFNGQV 120 Query: 301 INXNDTPTSLXMEXGDTIXVYQQQTGG 381 ++ DT + + G T+ + + GG Sbjct: 121 LSDEDTFEKVGIFAGATLHLIVRLLGG 147 >SB_1049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 411 Score = 29.9 bits (64), Expect = 1.9 Identities = 9/26 (34%), Positives = 19/26 (73%) Frame = +3 Query: 6 TTPSHKLSFTRSFVKTDTKSVCQFTV 83 +TP K +FTR FV+++ ++ C++ + Sbjct: 78 STPKGKTNFTRKFVRSEEQTTCEYRI 103 >SB_35774| Best HMM Match : DSPc (HMM E-Value=1e-26) Length = 1418 Score = 29.1 bits (62), Expect = 3.3 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +1 Query: 49 KQIPNQFVNSQFCINS-F*NHINLKMADEKKGENEHINLKVLXQDNAIVQFKIKKH 213 K NQ + Q CI F NLK+AD+ G + + KV A VQ +K++ Sbjct: 201 KYYENQISSDQTCIKEWFETEENLKIADDSVGISFQLFFKVRELVEAEVQMDLKQY 256 >SB_30516| Best HMM Match : GETHR (HMM E-Value=0.9) Length = 1058 Score = 27.9 bits (59), Expect = 7.7 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 336 GXGRHNXGLPTADRRSVPSVNLIILRIDHLQWVKINEVYPSQALTLS 476 G G+ + GL TA ++PSV L +DHL V + E + L ++ Sbjct: 977 GDGKEHFGLKTALHANMPSVWLPYTTLDHL-LVALGEASENSTLAIA 1022 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,693,247 Number of Sequences: 59808 Number of extensions: 309015 Number of successful extensions: 517 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 483 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 517 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -