BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_A16 (651 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0512 + 10101274-10102248,10102363-10102748,10103807-10104503 27 9.8 >09_02_0512 + 10101274-10102248,10102363-10102748,10103807-10104503 Length = 685 Score = 27.5 bits (58), Expect = 9.8 Identities = 17/75 (22%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = -1 Query: 315 LESPLTSQEELGRNGLFS*LLITFKIRHENYFIAVALXFRLYLPKLVYPIFASR--KSDK 142 L S T ++ + L +TF I +Y ++ ++ R LP++V F++ S + Sbjct: 193 LASGTTMTADISYDSSAEILAVTFWINGTSYHVSASVDMRRCLPEVVAVGFSASTGSSIE 252 Query: 141 IHKLIFHSIEFWFSW 97 +H+++ S +W Sbjct: 253 VHRVLSWSFNSTLTW 267 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,525,131 Number of Sequences: 37544 Number of extensions: 238558 Number of successful extensions: 453 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -