BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_A14 (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 6.3 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 23 6.3 AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. 23 6.3 AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 23 6.3 AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi... 23 8.4 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.4 bits (48), Expect = 6.3 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = +2 Query: 326 WNTLLWHQDSCRNVKWSHKERP 391 W+ QD+ R+ +W+H+ P Sbjct: 941 WDADALQQDASRHTRWTHRVIP 962 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.4 bits (48), Expect = 6.3 Identities = 12/48 (25%), Positives = 19/48 (39%) Frame = +1 Query: 316 VDLMEHAAVAPGFVSKCQMVAQGETAAGHAVVVPAADNTLAAGQCIHD 459 VDL++ APGF K + A V N + C+++ Sbjct: 267 VDLIDQLLKAPGFDGKSSLTLSEIAAQVFLFVAAYETNAITTFYCLYE 314 >AF469165-1|AAL68692.1| 226|Anopheles gambiae amylase protein. Length = 226 Score = 23.4 bits (48), Expect = 6.3 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +3 Query: 240 VWVARNPPGFAFVEFEDPRDAEDSVRGLDGTRCCGTRIRVE 362 +W A PPG E+ D E DGT C GTR+ V+ Sbjct: 171 IWKACLPPG----EYCDIISGER-----DGTMCTGTRVLVD 202 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +2 Query: 578 QCETLIVLXPVHVEKCRVE*FGIL 649 QCET +L H + R+E FG L Sbjct: 797 QCETTQLLTFAHANQRRIEDFGRL 820 >AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium channel alpha subunitprotein. Length = 2139 Score = 23.0 bits (47), Expect = 8.4 Identities = 10/53 (18%), Positives = 21/53 (39%) Frame = +1 Query: 316 VDLMEHAAVAPGFVSKCQMVAQGETAAGHAVVVPAADNTLAAGQCIHDGRLQF 474 + H + G + ++ + H++V P N L+ + H G+ F Sbjct: 644 ISYTSHGDLLGGMTKESRLRNRSARNTNHSIVPPPNANNLSYAETNHKGQRDF 696 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 607,502 Number of Sequences: 2352 Number of extensions: 11347 Number of successful extensions: 46 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -