SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P03_F_A07
         (626 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC032797-1|AAH32797.1|  247|Homo sapiens non-SMC element 2, MMS2...    31   4.4  

>BC032797-1|AAH32797.1|  247|Homo sapiens non-SMC element 2, MMS21
           homolog (S. cerevisiae) protein.
          Length = 247

 Score = 30.7 bits (66), Expect = 4.4
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
 Frame = +2

Query: 122 HKGNDEPMEIPINKMSQRKRFVIVN--NHVKELQGEQDDTN-KANKKEIIKQCSLQLDKM 292
           H   + P +IP  K+   K+F+ +   N   + Q  +     K   KE+ KQC LQ D+ 
Sbjct: 88  HVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADRE 147

Query: 293 SXNSE 307
           +  +E
Sbjct: 148 ADGTE 152


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,542,135
Number of Sequences: 237096
Number of extensions: 1231562
Number of successful extensions: 2392
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2349
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2392
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6804036910
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -