BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= fe100P03_F_A07
(626 letters)
Database: human
237,096 sequences; 76,859,062 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
BC032797-1|AAH32797.1| 247|Homo sapiens non-SMC element 2, MMS2... 31 4.4
>BC032797-1|AAH32797.1| 247|Homo sapiens non-SMC element 2, MMS21
homolog (S. cerevisiae) protein.
Length = 247
Score = 30.7 bits (66), Expect = 4.4
Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 3/65 (4%)
Frame = +2
Query: 122 HKGNDEPMEIPINKMSQRKRFVIVN--NHVKELQGEQDDTN-KANKKEIIKQCSLQLDKM 292
H + P +IP K+ K+F+ + N + Q + K KE+ KQC LQ D+
Sbjct: 88 HVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADRE 147
Query: 293 SXNSE 307
+ +E
Sbjct: 148 ADGTE 152
Database: human
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 76,859,062
Number of sequences in database: 237,096
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,542,135
Number of Sequences: 237096
Number of extensions: 1231562
Number of successful extensions: 2392
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2349
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2392
length of database: 76,859,062
effective HSP length: 87
effective length of database: 56,231,710
effective search space used: 6804036910
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -