BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P03_F_A07 (626 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g32460.1 68415.m03965 myb family transcription factor (MYB101... 27 7.7 At1g52990.1 68414.m05997 thioredoxin family protein similar to S... 27 7.7 >At2g32460.1 68415.m03965 myb family transcription factor (MYB101) identical to putative transcription factor MYB101 GI:18087348 from [Arabidopsis thaliana] Length = 490 Score = 27.5 bits (58), Expect = 7.7 Identities = 16/59 (27%), Positives = 24/59 (40%) Frame = +2 Query: 83 DIVYFLVTTIMVVHKGNDEPMEIPINKMSQRKRFVIVNNHVKELQGEQDDTNKANKKEI 259 D F + + + N +P++ S V NH+ E E DT NKK+I Sbjct: 213 DFQMFSLYNNSLENDNNQFGFSVPLSSSSSSNE-VCNPNHILEYISENSDTRNTNKKDI 270 >At1g52990.1 68414.m05997 thioredoxin family protein similar to SP|P48384 Thioredoxin M-type, chloroplast precursor (TRX-M) {Pisum sativum}; contains Pfam profile PF00085: Thioredoxin Length = 313 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/58 (29%), Positives = 32/58 (55%), Gaps = 4/58 (6%) Frame = -3 Query: 573 SIGNCVPSSLKTIFLFLVHRHSS--SESVXKVLLRPXV--SVFNKCPYFLXXXFSTVL 412 +I + +PS T F+F HR + ++++ K ++ S+FN CP+FL ++L Sbjct: 141 TIKSWIPSFTSTEFIF-THREQNQCADTLVKKAIKSSTQWSLFNCCPHFLYPIVLSIL 197 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,014,838 Number of Sequences: 28952 Number of extensions: 186136 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1275599520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -