BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_P20 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0695 - 19547101-19548010,19548089-19548587,19549461-195497... 27 9.8 02_05_0911 + 32686737-32686872,32686982-32687017,32687761-32687780 27 9.8 >09_04_0695 - 19547101-19548010,19548089-19548587,19549461-19549728, 19551025-19551687,19551849-19552060,19552203-19552593, 19552659-19553107,19553454-19553790 Length = 1242 Score = 27.5 bits (58), Expect = 9.8 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = -1 Query: 502 LQDRLLCHVDHVLGFRENGNDCDYALVCRCEA*VHEVLNAGTH 374 +++RL +D++ G EN C YA+V A HE + H Sbjct: 176 VRERLGPKMDYIPGLPENHPACGYAVVVADAAMEHEAMRLYNH 218 >02_05_0911 + 32686737-32686872,32686982-32687017,32687761-32687780 Length = 63 Score = 27.5 bits (58), Expect = 9.8 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +3 Query: 498 WSTWWNYYVFSCGKNC 545 W WW+ +VF+C C Sbjct: 17 WREWWDGFVFACNTPC 32 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,916,822 Number of Sequences: 37544 Number of extensions: 294713 Number of successful extensions: 708 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 693 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 708 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -