BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_P20 (652 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D82060-1|BAA11528.1| 429|Homo sapiens membrane protein with his... 58 2e-08 BC000645-1|AAH00645.1| 469|Homo sapiens solute carrier family 3... 58 2e-08 AL844527-11|CAI41839.1| 469|Homo sapiens solute carrier family ... 58 2e-08 AL844527-10|CAM25786.1| 220|Homo sapiens solute carrier family ... 58 2e-08 AL662824-23|CAI17615.1| 469|Homo sapiens solute carrier family ... 58 2e-08 AL662824-22|CAM24944.1| 220|Homo sapiens solute carrier family ... 58 2e-08 AL645940-9|CAI18067.1| 469|Homo sapiens solute carrier family 3... 58 2e-08 AL645940-8|CAM25432.1| 220|Homo sapiens solute carrier family 3... 58 2e-08 AL031228-11|CAA20238.1| 469|Homo sapiens solute carrier family ... 58 2e-08 AF117221-1|AAD12305.1| 429|Homo sapiens KE4 protein protein. 58 2e-08 U41060-1|AAA96258.2| 749|Homo sapiens estrogen regulated LIV-1 ... 38 0.023 BC039498-1|AAH39498.1| 433|Homo sapiens SLC39A6 protein protein. 38 0.023 BC019016-1|AAH19016.1| 364|Homo sapiens solute carrier family 3... 38 0.023 BC008853-1|AAH08853.2| 371|Homo sapiens SLC39A13 protein protein. 38 0.023 AK098651-1|BAC05365.1| 325|Homo sapiens protein ( Homo sapiens ... 38 0.023 BC027884-1|AAH27884.1| 539|Homo sapiens solute carrier family 3... 36 0.095 AK172768-1|BAD18751.1| 540|Homo sapiens protein ( Homo sapiens ... 36 0.095 BC112223-1|AAI12224.1| 831|Homo sapiens solute carrier family 3... 34 0.51 BC101516-1|AAI01517.1| 831|Homo sapiens solute carrier family 3... 34 0.51 AB033091-1|BAA86579.1| 835|Homo sapiens KIAA1265 protein protein. 34 0.51 BC117323-1|AAI17324.1| 691|Homo sapiens SLC39A12 protein protein. 31 2.7 BC094700-1|AAH94700.1| 691|Homo sapiens SLC39A12 protein protein. 31 2.7 BC065917-1|AAH65917.1| 524|Homo sapiens SLC39A12 protein protein. 31 2.7 BC035118-1|AAH35118.1| 309|Homo sapiens SLC39A12 protein protein. 31 2.7 AL590111-2|CAI15903.1| 654|Homo sapiens solute carrier family 3... 31 2.7 AL590111-1|CAI15904.1| 690|Homo sapiens solute carrier family 3... 31 2.7 AL360231-2|CAH70124.1| 654|Homo sapiens solute carrier family 3... 31 2.7 AL360231-1|CAH70123.1| 690|Homo sapiens solute carrier family 3... 31 2.7 AK055061-1|BAB70848.1| 654|Homo sapiens protein ( Homo sapiens ... 31 2.7 BC062625-1|AAH62625.1| 647|Homo sapiens solute carrier family 3... 30 6.2 AK025537-1|BAB15164.1| 647|Homo sapiens protein ( Homo sapiens ... 30 6.2 AK000334-1|BAA91091.1| 626|Homo sapiens protein ( Homo sapiens ... 30 6.2 >D82060-1|BAA11528.1| 429|Homo sapiens membrane protein with histidine rich charge clusters protein. Length = 429 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 168 LLQILLSFASGGLLGDAFLHLIPHALEPHS 197 >BC000645-1|AAH00645.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 168 LLQILLSFASGGLLGDAFLHLIPHALEPHS 197 >AL844527-11|CAI41839.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 168 LLQILLSFASGGLLGDAFLHLIPHALEPHS 197 >AL844527-10|CAM25786.1| 220|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 220 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 78 LLQILLSFASGGLLGDAFLHLIPHALEPHS 107 >AL662824-23|CAI17615.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 168 LLQILLSFASGGLLGDAFLHLIPHALEPHS 197 >AL662824-22|CAM24944.1| 220|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 220 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 78 LLQILLSFASGGLLGDAFLHLIPHALEPHS 107 >AL645940-9|CAI18067.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 168 LLQILLSFASGGLLGDAFLHLIPHALEPHS 197 >AL645940-8|CAM25432.1| 220|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 220 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 78 LLQILLSFASGGLLGDAFLHLIPHALEPHS 107 >AL031228-11|CAA20238.1| 469|Homo sapiens solute carrier family 39 (zinc transporter), member 7 protein. Length = 469 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 168 LLQILLSFASGGLLGDAFLHLIPHALEPHS 197 >AF117221-1|AAD12305.1| 429|Homo sapiens KE4 protein protein. Length = 429 Score = 58.4 bits (135), Expect = 2e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL+ILL+FASGGLLGDAFLHLIPHAL PH+ Sbjct: 168 LLQILLSFASGGLLGDAFLHLIPHALEPHS 197 >U41060-1|AAA96258.2| 749|Homo sapiens estrogen regulated LIV-1 protein protein. Length = 749 Score = 38.3 bits (85), Expect = 0.023 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL L+A A G L GDAFLHL+PH+ H+ Sbjct: 351 LLSFLVALAVGTLSGDAFLHLLPHSHASHH 380 >BC039498-1|AAH39498.1| 433|Homo sapiens SLC39A6 protein protein. Length = 433 Score = 38.3 bits (85), Expect = 0.023 Identities = 17/30 (56%), Positives = 21/30 (70%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL L+A A G L GDAFLHL+PH+ H+ Sbjct: 82 LLSFLVALAVGTLSGDAFLHLLPHSHASHH 111 >BC019016-1|AAH19016.1| 364|Homo sapiens solute carrier family 39 (zinc transporter), member 13 protein. Length = 364 Score = 38.3 bits (85), Expect = 0.023 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +1 Query: 331 LKILLAFASGGLLGDAFLHLIPHA 402 LK LL+FA GGLLG+ FLHL+P A Sbjct: 106 LKQLLSFALGGLLGNVFLHLLPEA 129 >BC008853-1|AAH08853.2| 371|Homo sapiens SLC39A13 protein protein. Length = 371 Score = 38.3 bits (85), Expect = 0.023 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +1 Query: 331 LKILLAFASGGLLGDAFLHLIPHA 402 LK LL+FA GGLLG+ FLHL+P A Sbjct: 106 LKQLLSFALGGLLGNVFLHLLPEA 129 >AK098651-1|BAC05365.1| 325|Homo sapiens protein ( Homo sapiens cDNA FLJ25785 fis, clone TST06832. ). Length = 325 Score = 38.3 bits (85), Expect = 0.023 Identities = 17/24 (70%), Positives = 20/24 (83%) Frame = +1 Query: 331 LKILLAFASGGLLGDAFLHLIPHA 402 LK LL+FA GGLLG+ FLHL+P A Sbjct: 106 LKQLLSFALGGLLGNVFLHLLPEA 129 >BC027884-1|AAH27884.1| 539|Homo sapiens solute carrier family 39 (metal ion transporter), member 5 protein. Length = 539 Score = 36.3 bits (80), Expect = 0.095 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +1 Query: 322 QPLLKILLAFASGGLLGDAFLHLIPHA 402 +PLL L A A G L GDA LHL+PHA Sbjct: 242 RPLLGFLGALAVGTLCGDALLHLLPHA 268 >AK172768-1|BAD18751.1| 540|Homo sapiens protein ( Homo sapiens cDNA FLJ23929 fis, clone COL05747. ). Length = 540 Score = 36.3 bits (80), Expect = 0.095 Identities = 17/27 (62%), Positives = 19/27 (70%) Frame = +1 Query: 322 QPLLKILLAFASGGLLGDAFLHLIPHA 402 +PLL L A A G L GDA LHL+PHA Sbjct: 243 RPLLGFLGALAVGTLCGDALLHLLPHA 269 >BC112223-1|AAI12224.1| 831|Homo sapiens solute carrier family 39 (zinc transporter), member 10 protein. Length = 831 Score = 33.9 bits (74), Expect = 0.51 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL L+A A G + GDA LHL+PH+ H+ Sbjct: 439 LLTFLVALAVGTMSGDALLHLLPHSQGGHD 468 >BC101516-1|AAI01517.1| 831|Homo sapiens solute carrier family 39 (zinc transporter), member 10 protein. Length = 831 Score = 33.9 bits (74), Expect = 0.51 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL L+A A G + GDA LHL+PH+ H+ Sbjct: 439 LLTFLVALAVGTMSGDALLHLLPHSQGGHD 468 >AB033091-1|BAA86579.1| 835|Homo sapiens KIAA1265 protein protein. Length = 835 Score = 33.9 bits (74), Expect = 0.51 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHN 417 LL L+A A G + GDA LHL+PH+ H+ Sbjct: 443 LLTFLVALAVGTMSGDALLHLLPHSQGGHD 472 >BC117323-1|AAI17324.1| 691|Homo sapiens SLC39A12 protein protein. Length = 691 Score = 31.5 bits (68), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDK 423 +L++ + A G L GDA LHLIP L H + Sbjct: 400 ILQLFVGLAVGTLSGDALLHLIPQVLGLHKQE 431 >BC094700-1|AAH94700.1| 691|Homo sapiens SLC39A12 protein protein. Length = 691 Score = 31.5 bits (68), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDK 423 +L++ + A G L GDA LHLIP L H + Sbjct: 400 ILQLFVGLAVGTLSGDALLHLIPQVLGLHKQE 431 >BC065917-1|AAH65917.1| 524|Homo sapiens SLC39A12 protein protein. Length = 524 Score = 31.5 bits (68), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDK 423 +L++ + A G L GDA LHLIP L H + Sbjct: 400 ILQLFVGLAVGTLSGDALLHLIPQVLGLHKQE 431 >BC035118-1|AAH35118.1| 309|Homo sapiens SLC39A12 protein protein. Length = 309 Score = 31.5 bits (68), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDK 423 +L++ + A G L GDA LHLIP L H + Sbjct: 19 ILQLFVGLAVGTLSGDALLHLIPQVLGLHKQE 50 >AL590111-2|CAI15903.1| 654|Homo sapiens solute carrier family 39 (zinc transporter), member 12 protein. Length = 654 Score = 31.5 bits (68), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDK 423 +L++ + A G L GDA LHLIP L H + Sbjct: 400 ILQLFVGLAVGTLSGDALLHLIPQVLGLHKQE 431 >AL590111-1|CAI15904.1| 690|Homo sapiens solute carrier family 39 (zinc transporter), member 12 protein. Length = 690 Score = 31.5 bits (68), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDK 423 +L++ + A G L GDA LHLIP L H + Sbjct: 400 ILQLFVGLAVGTLSGDALLHLIPQVLGLHKQE 431 >AL360231-2|CAH70124.1| 654|Homo sapiens solute carrier family 39 (zinc transporter), member 12 protein. Length = 654 Score = 31.5 bits (68), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDK 423 +L++ + A G L GDA LHLIP L H + Sbjct: 400 ILQLFVGLAVGTLSGDALLHLIPQVLGLHKQE 431 >AL360231-1|CAH70123.1| 690|Homo sapiens solute carrier family 39 (zinc transporter), member 12 protein. Length = 690 Score = 31.5 bits (68), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDK 423 +L++ + A G L GDA LHLIP L H + Sbjct: 400 ILQLFVGLAVGTLSGDALLHLIPQVLGLHKQE 431 >AK055061-1|BAB70848.1| 654|Homo sapiens protein ( Homo sapiens cDNA FLJ30499 fis, clone BRAWH2000443, weakly similar to Human breast cancer, estrogen regulated LIV-1 protein (LIV-1) ). Length = 654 Score = 31.5 bits (68), Expect = 2.7 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDK 423 +L++ + A G L GDA LHLIP L H + Sbjct: 400 ILQLFVGLAVGTLSGDALLHLIPQVLGLHKQE 431 >BC062625-1|AAH62625.1| 647|Homo sapiens solute carrier family 39 (zinc transporter), member 4 protein. Length = 647 Score = 30.3 bits (65), Expect = 6.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDKQ 426 +L+ L+ A G L GDA LHL P L H + Sbjct: 360 ILQTFLSLAVGALTGDAVLHLTPKVLGLHTHSE 392 >AK025537-1|BAB15164.1| 647|Homo sapiens protein ( Homo sapiens cDNA: FLJ21884 fis, clone HEP02863. ). Length = 647 Score = 30.3 bits (65), Expect = 6.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDKQ 426 +L+ L+ A G L GDA LHL P L H + Sbjct: 360 ILQTFLSLAVGALTGDAVLHLTPKVLGLHTHSE 392 >AK000334-1|BAA91091.1| 626|Homo sapiens protein ( Homo sapiens cDNA FLJ20327 fis, clone HEP10012. ). Length = 626 Score = 30.3 bits (65), Expect = 6.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = +1 Query: 328 LLKILLAFASGGLLGDAFLHLIPHALMPHNDKQ 426 +L+ L+ A G L GDA LHL P L H + Sbjct: 335 ILQTFLSLAVGALTGDAVLHLTPKVLGLHTHSE 367 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,352,288 Number of Sequences: 237096 Number of extensions: 1814986 Number of successful extensions: 3556 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 3418 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3556 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7253890590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -