BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_P18 (652 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g55270.1 68416.m06138 MAP kinase phosphatase (MKP1) identical... 31 0.66 At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)... 29 2.7 At5g17850.1 68418.m02092 cation exchanger, putative (CAX8) simil... 28 4.7 At3g46550.1 68416.m05053 fasciclin-like arabinogalactan family p... 28 4.7 At2g37290.1 68415.m04574 RabGAP/TBC domain-containing protein lo... 28 4.7 At5g51540.1 68418.m06391 peptidase M3 family protein / thimet ol... 27 8.2 At5g42450.1 68418.m05168 pentatricopeptide (PPR) repeat-containi... 27 8.2 At2g07727.1 68415.m00977 cytochrome b (MTCYB) (COB) (CYTB) conta... 27 8.2 >At3g55270.1 68416.m06138 MAP kinase phosphatase (MKP1) identical to MAP kinase phosphatase (MKP1) GI:13540262 from [Arabidopsis thaliana] Length = 534 Score = 31.1 bits (67), Expect = 0.66 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 4/52 (7%) Frame = +3 Query: 12 PTRGRSARPYSRPRPTRRA-PAMFDVFGSVKGLLKLDSVCIDNN---VFRLH 155 P R + +P P R+A P++ + GS+KG LKL + N F LH Sbjct: 309 PKESRGVNTFLQPSPNRKASPSLAERRGSLKGSLKLPGLADSNRGTPAFTLH 360 >At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28) identical to cDNA DEAD box RNA helicase, RH28 GI:3776026 Length = 789 Score = 29.1 bits (62), Expect = 2.7 Identities = 15/51 (29%), Positives = 28/51 (54%) Frame = -3 Query: 326 DAADKSVRDGESRVYPAVRVHNGERDFINDAVNRVTDVLSRRDEKRERDQD 174 D++++ V++GE+ + A +GE ++ + D DEKR+RD D Sbjct: 23 DSSEEDVKEGEAEEHEAGEDEDGEEEYEEE-----DDDEEEEDEKRKRDAD 68 >At5g17850.1 68418.m02092 cation exchanger, putative (CAX8) similar to sodium/calcium exchanger protein [Mus musculus] gi|13925661|gb|AAK49407; Ca2+:Cation Antiporter (CaCA) Family member PMID:11500563 Length = 559 Score = 28.3 bits (60), Expect = 4.7 Identities = 15/62 (24%), Positives = 30/62 (48%), Gaps = 2/62 (3%) Frame = +3 Query: 282 IYSTFTIPNRLIGRVGKDYVQPGV--GPHVEGQDEXKYHKYYQWVCFVLFFQAILFYVPR 455 I+ ++ ++ R G + ++ GV G H D+ + +YY W V++ + +PR Sbjct: 260 IHKRGSLSEPILQRDGLEEIEDGVVNGEHQIVDDDDDHQRYYYWKRLVIWAITLPLNLPR 319 Query: 456 YL 461 L Sbjct: 320 IL 321 >At3g46550.1 68416.m05053 fasciclin-like arabinogalactan family protein similar to fasciclin-like arabinogalactan protein FLA8 [Arabidopsis thaliana] gi|10880493|gb|AAG24276 Length = 420 Score = 28.3 bits (60), Expect = 4.7 Identities = 16/54 (29%), Positives = 30/54 (55%) Frame = +1 Query: 241 LMKSRSPLWTRTAGYTLLSPSRTDLSAASERITCNPASAHMSKDKTXLNITNII 402 L++++ P T +L+ P+ D++A SE +T P S +S +N+T I+ Sbjct: 160 LLETKPPNITVLTVDSLIVPTGIDITA-SETLTPPPTSTSLSPPPAGINLTQIL 212 >At2g37290.1 68415.m04574 RabGAP/TBC domain-containing protein low similarity to Rab6 GTPase activating protein, GAPCenA [Homo sapiens] GI:12188746; contains Pfam profile PF00566: TBC domain Length = 882 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/41 (29%), Positives = 23/41 (56%) Frame = -3 Query: 293 SRVYPAVRVHNGERDFINDAVNRVTDVLSRRDEKRERDQDN 171 SRV NG+++ ++D + + + LS +E E D+D+ Sbjct: 238 SRVKNVKSTKNGQKNIVDDHASSIKESLSSIEESGENDRDS 278 >At5g51540.1 68418.m06391 peptidase M3 family protein / thimet oligopeptidase family protein low similarity to SP|Q99797 Mitochondrial intermediate peptidase, mitochondrial precursor (EC 3.4.24.59) {Homo sapiens}; contains Pfam profile PF01432: Peptidase family M3 Length = 860 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/58 (24%), Positives = 29/58 (50%) Frame = +3 Query: 60 RRAPAMFDVFGSVKGLLKLDSVCIDNNVFRLHYKATVIILIAFSLLVTSRQYIGDPID 233 RRAP VF S +G K + + N F L + I+++ +++ + ++ + +D Sbjct: 763 RRAPVEKPVFMSEEGAAKAEEQRQNENAFLLTWLGLGIVILIEGIILAASGFLPEELD 820 >At5g42450.1 68418.m05168 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 396 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/31 (32%), Positives = 22/31 (70%) Frame = +1 Query: 364 SKDKTXLNITNIISGFVLCYSFKQSCFMFPA 456 ++D ++ITN+ISG++ + F+++ +F A Sbjct: 33 TRDPNVVSITNLISGYLKKHEFEEALSLFRA 63 >At2g07727.1 68415.m00977 cytochrome b (MTCYB) (COB) (CYTB) contains Pfam profile PF00033: Cytochrome b(N-terminal)/b6/petB; ontains Pfam profile PF00032: Cytochrome b(C-terminal)/b6/petD; 99% identical to apocytochrome B (GI:6851014), cytochrome b (GI:402962), and Cytochrome b (Swiss-Prot:P42792) [Arabidopsis thaliana] Length = 393 Score = 27.5 bits (58), Expect = 8.2 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 6/43 (13%) Frame = +3 Query: 351 VGPHVEGQDEXKYHKYYQ------WVCFVLFFQAILFYVPRYL 461 +G H E D+ ++ Y+ WV F +FF +FY P L Sbjct: 216 LGVHSE-MDKIAFYPYFYVKDLVGWVAFAIFFSIWIFYAPNVL 257 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,288,610 Number of Sequences: 28952 Number of extensions: 298001 Number of successful extensions: 886 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 855 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -