BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_P17 (653 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81038-4|CAB02768.2| 64|Caenorhabditis elegans Hypothetical pr... 83 2e-16 >Z81038-4|CAB02768.2| 64|Caenorhabditis elegans Hypothetical protein C25A1.6 protein. Length = 64 Score = 83.0 bits (196), Expect = 2e-16 Identities = 38/63 (60%), Positives = 49/63 (77%) Frame = +1 Query: 115 MYLRYYLNDKGDREYTLXTIDPFGKPTLSAHPARFSPEDKYSRHRIIIKKRFGLLLTQQP 294 M+LRY+L++ R YTL P G+ TL+AHPARFSPEDK S++RIIIKKRFGLL TQ+ Sbjct: 1 MFLRYFLDENQQRVYTLKRTAPSGEQTLTAHPARFSPEDKNSKYRIIIKKRFGLLPTQKA 60 Query: 295 EPI 303 + + Sbjct: 61 KTV 63 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,744,223 Number of Sequences: 27780 Number of extensions: 276181 Number of successful extensions: 532 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1455289764 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -