BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_P17 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 25 0.84 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 21 7.9 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 24.6 bits (51), Expect = 0.84 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -2 Query: 211 LDVLTMLVFQMGRWSXMCTLYRLYRLS 131 + VLT++ F M R+ +C R+Y +S Sbjct: 127 VSVLTIVAFSMERYLAICHPLRVYTIS 153 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.4 bits (43), Expect = 7.9 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -3 Query: 414 LLYXKSCVP*ILKRIVKMYQNLDHFGNFQYKSIFILMN 301 L+ K +K I + Y+N G + +S F+L+N Sbjct: 49 LILVKKSTAHFVKDIYEKYKNEPMVGLYATRSPFLLLN 86 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,195 Number of Sequences: 438 Number of extensions: 3468 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -