BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_P08 (651 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF067937-8|AAF99914.2| 232|Caenorhabditis elegans Hypothetical ... 66 2e-11 Z68220-5|CAA92490.2| 282|Caenorhabditis elegans Hypothetical pr... 28 5.0 >AF067937-8|AAF99914.2| 232|Caenorhabditis elegans Hypothetical protein F22F7.7 protein. Length = 232 Score = 66.1 bits (154), Expect = 2e-11 Identities = 37/97 (38%), Positives = 51/97 (52%), Gaps = 2/97 (2%) Frame = +3 Query: 324 NMWVFGYGSLIWKADFKYETKLVXYILXYKRRFYQHSVDHRGVPEKPGXVXTLIPSKFPN 503 ++W+FGYGSLIW F + T Y + + RR YQ + HRG + PG V TLI N Sbjct: 49 SLWIFGYGSLIWNPGFTFSTSRKAYAIGWARRMYQGNTYHRGDEKLPGRVATLIEE--TN 106 Query: 504 STVWGVAYRITAQ-XIHEVTKHL-HFTXKNGYSKKTV 608 S GV +R+ + I K+L NGY+ + V Sbjct: 107 SYTNGVVFRVDGKSAIATAVKYLEQRECDNGYAFRMV 143 >Z68220-5|CAA92490.2| 282|Caenorhabditis elegans Hypothetical protein T20D3.8 protein. Length = 282 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -1 Query: 150 HPVWTLQLHFCFFTKISTLYLF*FCKFL 67 H W++ + + F+ LYLF FCKFL Sbjct: 72 HSNWSINILYSVFSLTIVLYLF-FCKFL 98 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,213,774 Number of Sequences: 27780 Number of extensions: 283142 Number of successful extensions: 507 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1444744186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -