BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_P07 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.1 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 24 1.5 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 1.1 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +2 Query: 212 LPLTTRMPNIKVFSGSSHPDLAQKIVDRLGIDLGKVVTKKFSNMETC 352 LPL R G S LA+K+ DR+ + + V+T + + C Sbjct: 612 LPLNIRWSYPGEEMGGSSGVLAKKVADRVSMLMISVITARHAGEYVC 658 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 23.8 bits (49), Expect = 1.5 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = +2 Query: 212 LPLTTR-MPNIKVFSGSSHPDLAQKIVDRLGIDLGKVVTKKFSNM 343 +PL R +PN F S H + L +GK+V +KFS + Sbjct: 225 IPLPVRVLPN---FPSSGHWQDQMSLPQMLADKIGKMVNQKFSEL 266 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 164,870 Number of Sequences: 438 Number of extensions: 3090 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -