BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_P02 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 23 2.6 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.6 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 6.0 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 23.0 bits (47), Expect = 2.6 Identities = 17/70 (24%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = +1 Query: 127 VTGGLFLMYLAFRILYSL--IVQNNFMQTQYRAYGHTWRSIQCNKSIPYNIYCTVCEKLM 300 + GG L +L F +Y + +N T + W CN +I IY + Sbjct: 14 IVGGFILCWLPFFTMYLVRAFCRNCIHPTVFSVL--FWLGY-CNSAINPCIYALFSKDFR 70 Query: 301 LAVVGLFCEC 330 A + C+C Sbjct: 71 FAFKSIICKC 80 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.0 bits (47), Expect = 2.6 Identities = 17/70 (24%), Positives = 27/70 (38%), Gaps = 2/70 (2%) Frame = +1 Query: 127 VTGGLFLMYLAFRILYSL--IVQNNFMQTQYRAYGHTWRSIQCNKSIPYNIYCTVCEKLM 300 + GG L +L F +Y + +N T + W CN +I IY + Sbjct: 462 IVGGFILCWLPFFTMYLVRAFCRNCIHPTVFSVL--FWLGY-CNSAINPCIYALFSKDFR 518 Query: 301 LAVVGLFCEC 330 A + C+C Sbjct: 519 FAFKSIICKC 528 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 6.0 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -3 Query: 123 VISCNAVIINKVFHFPSNYCIFTK 52 V+SC A I+N +C TK Sbjct: 122 VLSCTASILNLCMISVDRFCAITK 145 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,804 Number of Sequences: 438 Number of extensions: 3429 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -