BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_O24 (650 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 23 2.9 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 23 2.9 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 22 5.0 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 22 5.0 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 22 5.0 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 21 6.7 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 405 ESFIXRYDVVLDEQWMNVLWSSVVSIF 485 ESF Y Q+ VLW S++++F Sbjct: 383 ESFKSPYKASCWAQFKAVLWRSILAVF 409 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 22.6 bits (46), Expect = 2.9 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 405 ESFIXRYDVVLDEQWMNVLWSSVVSIF 485 ESF Y Q+ VLW S++++F Sbjct: 383 ESFKSPYKASCWAQFKAVLWRSILAVF 409 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 524 VRAKYRAGTPADDEDRHHRR 465 VRAK + TPA++ D+ R Sbjct: 317 VRAKTQNATPANNNDKRKSR 336 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.8 bits (44), Expect = 5.0 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 115 DPRLVTCVHL*LCYGGQSSWFYPALPKIGDENLFNMYHNRY 237 DP L C HL Y G ++ + A P LF++ + Y Sbjct: 44 DPALQFCTHLIYGYAGINAETFKAQPL---NELFDVTRDNY 81 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.8 bits (44), Expect = 5.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -1 Query: 524 VRAKYRAGTPADDEDRHHRR 465 VRAK + TPA++ D+ R Sbjct: 317 VRAKTQNATPANNNDKRKSR 336 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.4 bits (43), Expect = 6.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 285 GWSFYLILAGVITTIGSSV 341 GW+ LILA IT+ SS+ Sbjct: 225 GWTLILILAKCITSSLSSL 243 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,729 Number of Sequences: 336 Number of extensions: 3259 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16760905 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -