BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_O24 (650 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.6 X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor pro... 21 7.8 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 515 KYRAGTPADDEDRHHRRPKNIHPLLVQHYI 426 KYR + DR R H ++ HYI Sbjct: 291 KYRETSKERSRDRRERGRSREHRIIPSHYI 320 >X72575-1|CAA51167.1| 168|Apis mellifera Apidaecin precursor protein. Length = 168 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = -2 Query: 613 VRHSKKSKAPAIHNAPVAIVAIFXPRLSAKYEPSIEP 503 +R +S+A +N PV I P + EP EP Sbjct: 88 LRREAESEAEPGNNRPVYIPQPRPPHPRLRREPEAEP 124 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,402 Number of Sequences: 438 Number of extensions: 3816 Number of successful extensions: 18 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19682733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -