BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_O20 (386 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g59540.1 68416.m06645 60S ribosomal protein L38 (RPL38B) 60S ... 54 4e-08 At2g43460.1 68415.m05401 60S ribosomal protein L38 (RPL38A) 54 4e-08 At1g06920.1 68414.m00735 ovate family protein 58% similar to ova... 30 0.62 >At3g59540.1 68416.m06645 60S ribosomal protein L38 (RPL38B) 60S RIBOSOMAL PROTEIN L38 - Lycopersicon esculentum, EMBL:X69979 Length = 69 Score = 53.6 bits (123), Expect = 4e-08 Identities = 28/70 (40%), Positives = 41/70 (58%) Frame = +2 Query: 68 MPREIKDIKDFLINGEEERRQIGQNKEEPXXXXXXXXXXXXXLYTLVITDKEKAEKLKQS 247 MP++I +IKDFL+ + + + K LYTL + D+EKA+KLKQS Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRY-LYTLCVFDQEKADKLKQS 59 Query: 248 LPPGLQVKEV 277 LPPGL V+++ Sbjct: 60 LPPGLSVQDL 69 >At2g43460.1 68415.m05401 60S ribosomal protein L38 (RPL38A) Length = 69 Score = 53.6 bits (123), Expect = 4e-08 Identities = 28/70 (40%), Positives = 41/70 (58%) Frame = +2 Query: 68 MPREIKDIKDFLINGEEERRQIGQNKEEPXXXXXXXXXXXXXLYTLVITDKEKAEKLKQS 247 MP++I +IKDFL+ + + + K LYTL + D+EKA+KLKQS Sbjct: 1 MPKQIHEIKDFLLTARRKDARSVKIKRSKDIVKFKVRCSRY-LYTLCVFDQEKADKLKQS 59 Query: 248 LPPGLQVKEV 277 LPPGL V+++ Sbjct: 60 LPPGLSVQDL 69 >At1g06920.1 68414.m00735 ovate family protein 58% similar to ovate protein (GI:23429649) [Lycopersicon esculentum]; contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 315 Score = 29.9 bits (64), Expect = 0.62 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +3 Query: 48 ENYSSSTCRVKSKISKTF*LTARRKDAKSVKIKKNPAECQVQ 173 E+ CR K K KT + RR AKS +IK ++Q Sbjct: 185 EDEEEDACRTKKKHQKTLVSSGRRSSAKSPRIKLRARSPRIQ 226 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,799,611 Number of Sequences: 28952 Number of extensions: 95568 Number of successful extensions: 245 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 241 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 241 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 547638520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -