BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_O14 (655 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 26 1.2 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 24 3.7 AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. 24 4.8 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 8.4 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 25.8 bits (54), Expect = 1.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 407 HPDVEKNATALREKLQAAVQNTVQESHKLAXKVSSNVQXT 526 H + E+NA + L A + TV ++H L+ S N T Sbjct: 316 HVEAERNARNAQHLLLRANRLTVSDNHNLSNSGSGNTAGT 355 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.2 bits (50), Expect = 3.7 Identities = 16/55 (29%), Positives = 23/55 (41%) Frame = +2 Query: 362 SRQNIERTAEELRKAHPDVEKNATALREKLQAAVQNTVQESHKLAXKVSSNVQXT 526 SR ++R E L A +NA R+ Q A +E+ KLA + T Sbjct: 1415 SRDLLQRAEEALYAA----SRNAEDARKNAQTAQDKYAEEASKLAENIKKRANAT 1465 >AF457565-1|AAL68795.1| 391|Anopheles gambiae TRIO protein protein. Length = 391 Score = 23.8 bits (49), Expect = 4.8 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 1/40 (2%) Frame = +2 Query: 401 KAHPDVEKNATALREKLQAAVQ-NTVQESHKLAXKVSSNV 517 KAHPD++++ L K + T+Q + SS+V Sbjct: 350 KAHPDLQQSVDDLMAKFNTPIDGKTLQYFQNIGISPSSSV 389 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 23.0 bits (47), Expect = 8.4 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +3 Query: 123 DGATRRSRLLQGHRTPHQGVP*DFRTTV*LAHQVKGRTGLQQGLEGRLRVRAA 281 DG++R R Q P QGVP + + QV +T Q G +G + V + Sbjct: 1113 DGSSRTVRQFQFITWPEQGVPKSGQGFIDFIGQVH-KTKEQFGQDGPITVHCS 1164 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 459,981 Number of Sequences: 2352 Number of extensions: 7000 Number of successful extensions: 34 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -