BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_O01 (593 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0590 + 22574985-22578018,22578125-22578469,22579171-225792... 32 0.40 03_02_0573 - 9571040-9571234,9571352-9571444,9571735-9571818,957... 29 3.7 04_03_0475 - 16343083-16344213,16344394-16345380,16345467-16345571 28 6.5 >06_03_0590 + 22574985-22578018,22578125-22578469,22579171-22579217, 22579450-22579573,22579622-22579686 Length = 1204 Score = 31.9 bits (69), Expect = 0.40 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = -2 Query: 361 LCKN*CPILCRLCCNTDSRRNFFLCLVPTAISGLQHRIVFHRSNTSYNLCS 209 LC C IL +C T+ R LC + +SG R + SNTS N CS Sbjct: 17 LCTFFCSILLAICNETEYDRQALLCF-KSQLSG-PSRALSSWSNTSLNFCS 65 >03_02_0573 - 9571040-9571234,9571352-9571444,9571735-9571818, 9572401-9572480,9572609-9572759,9573067-9573579 Length = 371 Score = 28.7 bits (61), Expect = 3.7 Identities = 18/42 (42%), Positives = 23/42 (54%) Frame = -3 Query: 429 AYKVQVNIDAAITQRFPVMVRMFFVRIDVPSFAGFVAIRTVD 304 A V V+ AA ++R PV VR +R+ V AGFV VD Sbjct: 84 ASSVVVSAAAAASRRLPVGVRKPPLRVVVTGGAGFVGSHLVD 125 >04_03_0475 - 16343083-16344213,16344394-16345380,16345467-16345571 Length = 740 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 247 VFHRSNTSYNLCSRKVSVSFWITQSCTIELREYDTKY 137 V H ++ YN C R SV WI + R+Y ++ Sbjct: 56 VSHLNDRCYNFCVRDKSVGLWIYNLRSYICRDYHMRF 92 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,384,993 Number of Sequences: 37544 Number of extensions: 239896 Number of successful extensions: 491 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 491 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -