BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_N20 (588 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 23 5.5 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 23.4 bits (48), Expect = 5.5 Identities = 10/37 (27%), Positives = 22/37 (59%) Frame = -1 Query: 561 PSQVEANLIKILXFLIPCSANKLINLIAFAMLASLSN 451 P Q+E ++ ++ L P S +KL+N + + +S+ + Sbjct: 658 PKQIEEAVMNLITNLQPDSEDKLLNTMPASPASSIKS 694 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,417 Number of Sequences: 2352 Number of extensions: 10805 Number of successful extensions: 52 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -