BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_N20 (588 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 5.1 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 5.1 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 22 5.1 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 22 5.1 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 22 5.1 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 21 6.8 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 21 6.8 S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor prot... 21 9.0 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.8 bits (44), Expect = 5.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 19 NVTXRERDCTYNFNAN*VCITNLQPVQYFISQYE 120 N+T +N AN TN V+ F+S Y+ Sbjct: 54 NITWYNEGQAWNIEANIDSYTNAAAVKEFLSIYK 87 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.8 bits (44), Expect = 5.1 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 19 NVTXRERDCTYNFNAN*VCITNLQPVQYFISQYE 120 N+T +N AN TN V+ F+S Y+ Sbjct: 54 NITWYNEGQAWNIEANIDSYTNAAAVKEFLSIYK 87 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.8 bits (44), Expect = 5.1 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 412 NNF*YFTPKKHTQHIQSFSHLXFNGASIILSI-FNSFI 302 +NF TP++ Q I S + F A II +I + SFI Sbjct: 430 HNFTTMTPQEIAQWIDRRSRIVFPVAFIIFNILYWSFI 467 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +3 Query: 276 VWNSISTFLIKLLNMERIMEAPLXNKWL 359 +W+ ST++ K+ N + + L N WL Sbjct: 318 IWDYDSTYIPKVKNKKAGSKHLLQNTWL 345 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.8 bits (44), Expect = 5.1 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -1 Query: 408 IFNISHPKSTLSISKVSATCXSMELPLS 325 ++ ISHPK L + K E P+S Sbjct: 327 VYAISHPKYRLELQKRLPWLELQEKPIS 354 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = -2 Query: 389 QKAHSAYPKFQPLVXQWSFHYPFHI 315 ++ Y +FQ L + FHY ++ Sbjct: 9 RRGRQTYTRFQTLELEKEFHYNHYL 33 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.4 bits (43), Expect = 6.8 Identities = 7/27 (25%), Positives = 17/27 (62%) Frame = +3 Query: 261 YSLLLVWNSISTFLIKLLNMERIMEAP 341 Y + L +NS+ F + +++++E+P Sbjct: 21 YFIFLYFNSLVRFRRFTIELDKVLESP 47 >S76959-1|AAB33934.1| 85|Apis mellifera olfactory receptor protein. Length = 85 Score = 21.0 bits (42), Expect = 9.0 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -1 Query: 411 IIFNISHPKSTLSISKVSATCXS 343 I+FNI H S K TC S Sbjct: 33 ILFNILHMSSAEGWFKAIGTCGS 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,835 Number of Sequences: 438 Number of extensions: 3064 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17115420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -