BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_N12 (649 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) 87 2e-17 SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 2e-16 SB_17563| Best HMM Match : DEAD (HMM E-Value=0) 58 5e-09 SB_2247| Best HMM Match : DEAD (HMM E-Value=0) 58 5e-09 SB_32980| Best HMM Match : DEAD (HMM E-Value=0) 54 1e-07 SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 2e-06 SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) 49 4e-06 SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 4e-06 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 48 5e-06 SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) 48 9e-06 SB_9558| Best HMM Match : DEAD (HMM E-Value=0) 47 1e-05 SB_37351| Best HMM Match : DEAD (HMM E-Value=0) 46 3e-05 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_52320| Best HMM Match : DEAD (HMM E-Value=0) 44 8e-05 SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) 44 1e-04 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 43 2e-04 SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 42 6e-04 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.038 SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.26 SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) 32 0.46 SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) 31 1.1 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 29 3.3 SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) 28 7.5 SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_55750| Best HMM Match : PWWP (HMM E-Value=6.4e-07) 27 9.9 SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_56998| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 86.6 bits (205), Expect = 2e-17 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = +2 Query: 356 GTLDTDWDQVVETFDDMNLKEXLLRGIYAYGFEKPSAIQQRAIMPCIQ 499 G ++WD+VVE+FDDMNLKE LLRGIYAYGFEKPSAIQQRAI PC Q Sbjct: 52 GKRQSNWDEVVESFDDMNLKEALLRGIYAYGFEKPSAIQQRAIRPCCQ 99 Score = 77.4 bits (182), Expect = 9e-15 Identities = 40/53 (75%), Positives = 46/53 (86%), Gaps = 6/53 (11%) Frame = +3 Query: 504 RDVIAQAQSGTGKTATFSISILQQIDTSIRE------CQALILAPTRELAQQI 644 RDVIAQAQSGTGKTATF+ISILQ+IDT+ ++ CQAL+LAPTRELAQQI Sbjct: 123 RDVIAQAQSGTGKTATFAISILQEIDTNYKDKNGCDCCQALVLAPTRELAQQI 175 >SB_52411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 83.0 bits (196), Expect = 2e-16 Identities = 40/48 (83%), Positives = 44/48 (91%) Frame = +3 Query: 501 GRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQI 644 GRDVIAQAQSGTGKTATFSIS+LQ IDT +RE QAL+L+PTRELA QI Sbjct: 34 GRDVIAQAQSGTGKTATFSISVLQAIDTQLREPQALVLSPTRELANQI 81 Score = 33.1 bits (72), Expect = 0.20 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +2 Query: 446 GFEKPSAIQQRAIMPCIQ 499 GFEKPSAIQQRAI P ++ Sbjct: 16 GFEKPSAIQQRAIKPILK 33 >SB_17563| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 58.4 bits (135), Expect = 5e-09 Identities = 26/51 (50%), Positives = 39/51 (76%) Frame = +3 Query: 489 LASXGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQ 641 +A GRD++A+A++GTGKTA + + +L++ DT+ QAL+L PTRELA Q Sbjct: 80 VALAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQ 130 Score = 36.3 bits (80), Expect = 0.021 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +2 Query: 395 FDDMNLKEXLLRGIYAYGFEKPSAIQQRAI 484 F+D LK LL GI+ GF+KPS IQ+ +I Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESI 78 >SB_2247| Best HMM Match : DEAD (HMM E-Value=0) Length = 439 Score = 58.4 bits (135), Expect = 5e-09 Identities = 26/51 (50%), Positives = 39/51 (76%) Frame = +3 Query: 489 LASXGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQ 641 +A GRD++A+A++GTGKTA + + +L++ DT+ QAL+L PTRELA Q Sbjct: 80 VALAGRDILARAKNGTGKTAAYLVPLLERTDTTKNCIQALVLVPTRELALQ 130 Score = 36.3 bits (80), Expect = 0.021 Identities = 16/30 (53%), Positives = 21/30 (70%) Frame = +2 Query: 395 FDDMNLKEXLLRGIYAYGFEKPSAIQQRAI 484 F+D LK LL GI+ GF+KPS IQ+ +I Sbjct: 49 FEDYCLKRELLMGIFEKGFDKPSPIQEESI 78 >SB_32980| Best HMM Match : DEAD (HMM E-Value=0) Length = 985 Score = 53.6 bits (123), Expect = 1e-07 Identities = 26/52 (50%), Positives = 34/52 (65%) Frame = +3 Query: 489 LASXGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQI 644 L G D+IAQA+SGTGKT FS+ L+ + T Q +IL PTRE+A Q+ Sbjct: 46 LGRCGLDLIAQAKSGTGKTCVFSVIALENVITESNCIQIIILTPTREIAVQV 97 Score = 33.1 bits (72), Expect = 0.20 Identities = 16/30 (53%), Positives = 19/30 (63%) Frame = +2 Query: 395 FDDMNLKEXLLRGIYAYGFEKPSAIQQRAI 484 F + L LLRG+ GFEKPS IQ +AI Sbjct: 15 FHSLLLSPTLLRGLNEAGFEKPSPIQLKAI 44 >SB_38262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1039 Score = 49.6 bits (113), Expect = 2e-06 Identities = 25/53 (47%), Positives = 37/53 (69%), Gaps = 2/53 (3%) Frame = +3 Query: 489 LASXGRDVIAQAQSGTGKTATFSISILQQIDTSIRE--CQALILAPTRELAQQ 641 L G+DV+A A++G+GKTA F I + +++ T + +ALIL+PTRELA Q Sbjct: 314 LVMDGKDVVAMARTGSGKTAAFLIPMFEKLQTHTAKVGIRALILSPTRELALQ 366 >SB_48046| Best HMM Match : DEAD (HMM E-Value=4e-38) Length = 475 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +3 Query: 492 ASXGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQI 644 A G D+I QA+SG GKTA F ++ LQQ++ + L++ TRELA QI Sbjct: 81 AILGMDIICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQI 131 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +2 Query: 395 FDDMNLKEXLLRGIYAYGFEKPSAIQQRAIMPCI 496 F D LK LLR I GFE PS +Q I I Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI 82 >SB_28853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 48.8 bits (111), Expect = 4e-06 Identities = 24/51 (47%), Positives = 33/51 (64%) Frame = +3 Query: 492 ASXGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQI 644 A G D+I QA+SG GKTA F ++ LQQ++ + L++ TRELA QI Sbjct: 81 AILGMDIICQAKSGMGKTAVFVLATLQQLEPVDGQVSVLVMCHTRELAFQI 131 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +2 Query: 395 FDDMNLKEXLLRGIYAYGFEKPSAIQQRAIMPCI 496 F D LK LLR I GFE PS +Q I I Sbjct: 49 FRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI 82 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 48.4 bits (110), Expect = 5e-06 Identities = 24/51 (47%), Positives = 36/51 (70%) Frame = +3 Query: 489 LASXGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQ 641 LA ++IAQ+QSGTGKTA F +++L ++D + Q + L+PT ELA+Q Sbjct: 138 LADPPVNMIAQSQSGTGKTAAFVLTMLSRVDATKPYPQVICLSPTYELARQ 188 Score = 35.1 bits (77), Expect = 0.050 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +2 Query: 389 ETFDDMNLKEXLLRGIYAYGFEKPSAIQQRAI 484 ++F+++ L L RG+Y GF KPS IQ+ A+ Sbjct: 103 KSFEELPLSANLRRGVYDMGFNKPSKIQETAL 134 >SB_44408| Best HMM Match : DEAD (HMM E-Value=6.8005e-42) Length = 238 Score = 47.6 bits (108), Expect = 9e-06 Identities = 24/47 (51%), Positives = 33/47 (70%) Frame = +3 Query: 504 RDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQI 644 +DVI A++G+GKT F++ ILQ + + + ALIL PTRELA QI Sbjct: 2 KDVIGLAETGSGKTGAFALPILQALLDNPQRLFALILTPTRELAFQI 48 >SB_9558| Best HMM Match : DEAD (HMM E-Value=0) Length = 436 Score = 47.2 bits (107), Expect = 1e-05 Identities = 24/48 (50%), Positives = 33/48 (68%) Frame = +3 Query: 501 GRDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQI 644 GRD I A++G+GKTA F++ ILQ++ A++L PTRELA QI Sbjct: 44 GRDCIGCAKTGSGKTAAFALPILQKLCDDPYGIFAVVLTPTRELAFQI 91 >SB_37351| Best HMM Match : DEAD (HMM E-Value=0) Length = 688 Score = 46.0 bits (104), Expect = 3e-05 Identities = 23/54 (42%), Positives = 39/54 (72%), Gaps = 6/54 (11%) Frame = +3 Query: 501 GRDVIAQAQSGTGKTATFSISILQQI-DTSI-----RECQALILAPTRELAQQI 644 G DVI QA++GTGKT +F++ +++++ D + R + L++APTRELA+Q+ Sbjct: 110 GEDVIGQARTGTGKTLSFALPLVEKLQDGKLSQKRGRAPKVLVMAPTRELAKQV 163 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 45.6 bits (103), Expect = 4e-05 Identities = 25/57 (43%), Positives = 37/57 (64%), Gaps = 5/57 (8%) Frame = +3 Query: 489 LASXGRDVIAQAQSGTGKTATFSISIL-----QQIDTSIRECQALILAPTRELAQQI 644 + GRD++A AQ+G+GKTA + + +L Q ++ R AL +APTRELA+QI Sbjct: 512 IVMAGRDLMACAQTGSGKTAAYMLPVLTSLIKQGLNAPPRSPLALCVAPTRELAKQI 568 >SB_52320| Best HMM Match : DEAD (HMM E-Value=0) Length = 340 Score = 44.4 bits (100), Expect = 8e-05 Identities = 25/55 (45%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = +3 Query: 489 LASXGRDVIAQAQSGTGKTATFSISILQ----QIDTSIRECQALILAPTRELAQQ 641 +A GRDV+ A++G+GKT F I I++ Q TS+ AL+++PTRELA Q Sbjct: 83 VALSGRDVLGAAKTGSGKTLAFLIPIIETLWRQKWTSMDGLGALVISPTRELAYQ 137 >SB_51015| Best HMM Match : DEAD (HMM E-Value=0.0057) Length = 96 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/54 (44%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = +3 Query: 489 LASXGRDVIAQAQSGTGKTATFSISILQQI---DTSIRECQALILAPTRELAQQ 641 +A G+DV A A +GTGKTA F + IL+++ T + L++ PTRELA Q Sbjct: 43 VALMGKDVCACAATGTGKTAAFMLPILERLLYRPTQSPAIRVLVITPTRELAIQ 96 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 43.2 bits (97), Expect = 2e-04 Identities = 26/57 (45%), Positives = 36/57 (63%), Gaps = 9/57 (15%) Frame = +3 Query: 501 GRDVIAQAQSGTGKTATFSISILQQI------DTSIREC---QALILAPTRELAQQI 644 GRDV+A AQ+G+GKTA F + ++ + +S E QA+ +APTRELA QI Sbjct: 748 GRDVMACAQTGSGKTAAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQI 804 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 42.7 bits (96), Expect = 2e-04 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 9/56 (16%) Frame = +3 Query: 504 RDVIAQAQSGTGKTATFSISIL---------QQIDTSIRECQALILAPTRELAQQI 644 RD+I A++G+GKTA F+I +L ++ + + + ALILAPTRELAQQI Sbjct: 139 RDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQI 194 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 42.3 bits (95), Expect = 3e-04 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 5/57 (8%) Frame = +3 Query: 489 LASXGRDVIAQAQSGTGKTATF----SISILQQIDTSIRECQ-ALILAPTRELAQQI 644 +A GRD+I A++G+GKTA F + I+ Q + + + LI APTREL QQI Sbjct: 550 IALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQI 606 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 41.5 bits (93), Expect = 6e-04 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 5/58 (8%) Frame = +3 Query: 486 CLASXGRDVIAQAQSGTGKTATFSISILQQIDTSIRECQ-----ALILAPTRELAQQI 644 C+ S GRD+I A++G+GKT +S+ + + T ALIL PTREL QQ+ Sbjct: 105 CVMS-GRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQV 161 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 35.5 bits (78), Expect = 0.038 Identities = 27/66 (40%), Positives = 35/66 (53%), Gaps = 19/66 (28%) Frame = +3 Query: 504 RDVIAQAQSGTGKTATFSISILQQIDT--------------SIRECQ-----ALILAPTR 626 RD+I A++G+GKT F I I+Q I+ S E Q ALI+APTR Sbjct: 169 RDIIGAAETGSGKTLAFGIPIIQHIEAYKKRKAEQSPSDKESDLESQGYPLLALIMAPTR 228 Query: 627 ELAQQI 644 ELA Q+ Sbjct: 229 ELALQV 234 >SB_11691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1448 Score = 33.9 bits (74), Expect = 0.11 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = +3 Query: 501 GRDVIAQAQSGTGKTATF---SISILQQIDTSIRE-CQALILAPTRELAQQ 641 GRD++ A++G+GKT F + +L ++ R +I++PTREL+ Q Sbjct: 609 GRDLLGAAKTGSGKTLAFLVPVVELLYKLQFKTRNGTGVIIISPTRELSLQ 659 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 32.7 bits (71), Expect = 0.26 Identities = 15/25 (60%), Positives = 20/25 (80%) Frame = +3 Query: 504 RDVIAQAQSGTGKTATFSISILQQI 578 RD++A AQ+G+GKTA F I IL +I Sbjct: 913 RDLMACAQTGSGKTAAFLIPILSRI 937 Score = 30.7 bits (66), Expect = 1.1 Identities = 14/38 (36%), Positives = 25/38 (65%) Frame = +2 Query: 395 FDDMNLKEXLLRGIYAYGFEKPSAIQQRAIMPCIQXTR 508 F+D++L E LL + G++KP+ +Q+ AI P ++ R Sbjct: 877 FEDVDLGEILLHNVGLAGYKKPTPVQKYAI-PIVKGKR 913 >SB_45527| Best HMM Match : DEAD (HMM E-Value=0.0069) Length = 120 Score = 31.9 bits (69), Expect = 0.46 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +3 Query: 588 IRECQALILAPTRELAQQI 644 +RE QAL+L+PTRELA QI Sbjct: 1 LREPQALVLSPTRELANQI 19 >SB_41683| Best HMM Match : DEAD (HMM E-Value=1.5e-27) Length = 559 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/47 (31%), Positives = 28/47 (59%) Frame = +3 Query: 504 RDVIAQAQSGTGKTATFSISILQQIDTSIRECQALILAPTRELAQQI 644 + ++ ++++GTGK+ F +L + R +I+ PTRELA Q+ Sbjct: 198 KSLLIKSETGTGKSLVF---LLPSVQDPGRGYGTIIVVPTRELASQM 241 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 29.1 bits (62), Expect = 3.3 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 248 NMSYSSERRSXDWPEDSKNGPSKDQGSYDGP 340 +M Y SER P D P+ D GS D P Sbjct: 1171 SMEYDSERHPYQAPADEMVNPNTDGGSRDNP 1201 >SB_33720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.9 bits (59), Expect = 7.5 Identities = 22/70 (31%), Positives = 29/70 (41%), Gaps = 3/70 (4%) Frame = +2 Query: 266 ERRSXDWPEDSKNGPSKDQGSYD---GPPGMDPGTLDTDWDQVVETFDDMNLKEXLLRGI 436 E+ + + E +K + D+G GPPG GT D VVE DD K G Sbjct: 19 EKTAEEMRELAKKAEACDRGVRAILLGPPGSGKGTQLVSDDLVVELIDDNLTKPECQNGW 78 Query: 437 YAYGFEKPSA 466 GF + A Sbjct: 79 LLDGFPRTVA 88 >SB_21533| Best HMM Match : TPD52 (HMM E-Value=5e-08) Length = 829 Score = 27.9 bits (59), Expect = 7.5 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 442 GVYASQQXFFEVHVIEGFDNLIPVGVKC 359 GVY F H + GF N IP +C Sbjct: 742 GVYLESNVFQNGHALVGFQNTIPASQEC 769 >SB_16235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4072 Score = 27.5 bits (58), Expect = 9.9 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +2 Query: 305 GPSKDQG-SYDGPPGMDPGTLDTDW-DQVVETFDDMNLKEXL 424 GP +QG S GPPG PG T W D +V +L E L Sbjct: 3363 GPKGEQGRSISGPPG-PPGAPGTSWNDSIVNGGLSNSLLESL 3403 >SB_55750| Best HMM Match : PWWP (HMM E-Value=6.4e-07) Length = 532 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +3 Query: 501 GRDVIAQAQSGTGKTATFSISILQQIDTSIRE 596 G DV+A + SGT K + F ++++ D+ R+ Sbjct: 247 GSDVVANSSSGTVKRSLFLPEVMEENDSVFRD 278 >SB_44173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 290 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMN 409 +D N + D G+ D D GT+D D D V+ DD N Sbjct: 71 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDN 107 >SB_30467| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 9.9 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +2 Query: 290 EDSKNGPSKDQGSYDGPPGMDPGTLDTDWDQVVETFDDMN 409 +D N + D G+ D D GT+D D D V+ DD N Sbjct: 54 DDDGNIDNDDDGNIDND---DDGTIDNDDDGYVDNVDDDN 90 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,097,022 Number of Sequences: 59808 Number of extensions: 352852 Number of successful extensions: 1564 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1553 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1645141000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -