BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_N06 (654 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.12 SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) 30 1.4 SB_20037| Best HMM Match : 7tm_1 (HMM E-Value=3.09687e-43) 28 7.6 >SB_23833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 43.6 bits (98), Expect = 1e-04 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = +1 Query: 292 MIPHKTXRGKNALXRLRTYDGCPPPFD 372 MIPHKT +G A+ R++ +DG PPP+D Sbjct: 1 MIPHKTKKGTEAMNRMKVFDGVPPPYD 27 >SB_46391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 33.9 bits (74), Expect = 0.12 Identities = 29/99 (29%), Positives = 41/99 (41%), Gaps = 12/99 (12%) Frame = +1 Query: 55 VIDGRGHLLGRLAAVIAKVLL------------EGNKVVVVRCEQINISGNFFTNKLKLM 198 +IDGR + GRLA I ++L G+ VVV+ + I +SG + NKL Sbjct: 20 LIDGRDQICGRLAGYIGQILQGKTKPIYHHAEDVGDYVVVINTKHIVLSGTKWDNKLYRH 79 Query: 199 SFLRKRCNVNPARGPFHFXAPSXILWKTVRGMIPHKTXR 315 H + ILW+ V GM+P R Sbjct: 80 HTGYPGGLKEILAKDLHRKDGTRILWRAVNGMLPKNNLR 118 >SB_31467| Best HMM Match : CTP_transf_2 (HMM E-Value=0.85) Length = 1459 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +2 Query: 59 SMAVVICWAVWRQSSPRSFSKGTKLLWFAANKSTSLA 169 SM+V +C ++W + P F +L+W+ + S S++ Sbjct: 265 SMSVSLCQSIWYHTHPSVFVSLGQLIWYNTHPSVSVS 301 >SB_20037| Best HMM Match : 7tm_1 (HMM E-Value=3.09687e-43) Length = 453 Score = 27.9 bits (59), Expect = 7.6 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 166 GNFFTNKLKLMSFLRKRCNVNPARGP 243 GN F+ L+L S R+ C+ NP+ P Sbjct: 318 GNVFSRPLRLFSRARRMCSWNPSDNP 343 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,634,581 Number of Sequences: 59808 Number of extensions: 378835 Number of successful extensions: 1532 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1530 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -