BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_M24 (653 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1148 - 34458732-34460627,34462299-34462547 31 0.80 03_04_0075 + 17066321-17066381,17066476-17067534,17067641-17067927 29 4.3 03_01_0586 - 4339090-4339194,4340186-4340366,4340531-4340601,434... 28 5.6 04_04_0463 - 25397837-25399693,25402136-25402405 28 7.5 08_01_0074 + 530207-532603 27 9.9 05_07_0034 - 27200513-27200605,27200750-27200802,27201724-272017... 27 9.9 01_01_0409 - 3084821-3084988,3085069-3085155,3085270-3085476,308... 27 9.9 >02_05_1148 - 34458732-34460627,34462299-34462547 Length = 714 Score = 31.1 bits (67), Expect = 0.80 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 526 LCVRNFRPALGFPCCSAYCIHCYHLHCLS 440 +C+ +P G +A C H +H HC++ Sbjct: 88 ICLTTMKPGQGHALFTAECSHTFHFHCIA 116 >03_04_0075 + 17066321-17066381,17066476-17067534,17067641-17067927 Length = 468 Score = 28.7 bits (61), Expect = 4.3 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +1 Query: 394 NARATHLSRARDDNVKKGNASGNSECSKRNNMETLAQGENFERKD 528 NARA R+R ++ G SG +EC ++ L+ G N RKD Sbjct: 255 NARAGD-GRSRRNSGGGGGHSGGTECIMGDSKRALSAGVNTPRKD 298 >03_01_0586 - 4339090-4339194,4340186-4340366,4340531-4340601, 4340689-4340826,4341342-4342337 Length = 496 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/65 (26%), Positives = 28/65 (43%) Frame = +1 Query: 448 NASGNSECSKRNNMETLAQGENFERKDATSQEKGSTENXXEXXXXXXXXXXXXXXDITSN 627 +A+ N+ S+ +++ +G + RK QEK +EN E +TSN Sbjct: 8 SANPNNHRSRSSDITRHQKGGSARRKSKPYQEKDDSENIDEFDTDIMSSKNGPPISLTSN 67 Query: 628 KRQHA 642 R A Sbjct: 68 SRPQA 72 >04_04_0463 - 25397837-25399693,25402136-25402405 Length = 708 Score = 27.9 bits (59), Expect = 7.5 Identities = 10/29 (34%), Positives = 15/29 (51%) Frame = -2 Query: 526 LCVRNFRPALGFPCCSAYCIHCYHLHCLS 440 +C + R G +A C H +H HC+S Sbjct: 95 ICFDSMRHGNGQALFTAECSHMFHFHCIS 123 >08_01_0074 + 530207-532603 Length = 798 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +1 Query: 358 IVYSTLTVHAXSNARATHLSRARDDNVKKGNASGNS 465 + Y+TL V+ N R+ + D VKKG+ +S Sbjct: 277 VTYNTLMVYLCKNGRSMEARKVFDSMVKKGHKPDSS 312 >05_07_0034 - 27200513-27200605,27200750-27200802,27201724-27201797, 27202762-27202830,27203070-27204148 Length = 455 Score = 27.5 bits (58), Expect = 9.9 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = -2 Query: 517 RNFRPALGFPCC 482 R++RPAL FPCC Sbjct: 159 RHYRPALRFPCC 170 >01_01_0409 - 3084821-3084988,3085069-3085155,3085270-3085476, 3085904-3085985,3086085-3086275,3086410-3086616, 3086709-3086871,3087905-3087960,3088035-3088148, 3088599-3089807 Length = 827 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -2 Query: 526 LCVRNFRPALGFPCCSAYCIHCYHLHCL 443 +C RP+ CSA C HLHC+ Sbjct: 111 ICFDPIRPSDPVWSCSASCFALLHLHCI 138 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,167,944 Number of Sequences: 37544 Number of extensions: 215919 Number of successful extensions: 445 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1632177336 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -