BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_M24 (653 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 23 6.4 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 8.4 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.4 bits (48), Expect = 6.4 Identities = 10/38 (26%), Positives = 20/38 (52%) Frame = -2 Query: 130 LLIDIKERFSFNYTSLYTAKRFNAFSYSKITKIPMPNL 17 L D+ + + ++ + A N F + T+IP+PN+ Sbjct: 28 LYFDVPDSYLTDHYRPFGAALQNRFGTNAQTRIPLPNI 65 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.0 bits (47), Expect = 8.4 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +1 Query: 415 SRARDDNVKKGNASGNSECSKRNNMETLAQGENFERKDATSQEK 546 + + ++N GN + N+ S NN +L G K+ T E+ Sbjct: 198 NNSNNNNNSSGNNNNNTISSNNNNNNSLHHGP-LRDKELTEHEQ 240 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 558,230 Number of Sequences: 2352 Number of extensions: 9572 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64814025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -