BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_M24 (653 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 25 0.84 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 7.9 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 7.9 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 24.6 bits (51), Expect = 0.84 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 205 YDPCCKLIIIT*HDNVVIKKIFNFSXLITKVILFSSTL 318 YD CC+ + + V + F FS LI V+ +S+ L Sbjct: 346 YDTCCQGRATAIYIDKVSRFFFPFSFLILNVVYWSTFL 383 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +1 Query: 205 YDPCCKLIIIT 237 Y PCC L+I++ Sbjct: 249 YIPCCMLVIVS 259 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 7.9 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = +1 Query: 205 YDPCCKLIIIT 237 Y PCC L+I++ Sbjct: 249 YIPCCMLVIVS 259 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,350 Number of Sequences: 438 Number of extensions: 2586 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19804986 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -