Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= fe100P02_F_M24
         (653 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    25   0.84 
DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chlor...    21   7.9  
DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chlor...    21   7.9  

>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 24.6 bits (51), Expect = 0.84
 Identities = 13/38 (34%), Positives = 20/38 (52%)
 Frame = +1

Query: 205 YDPCCKLIIIT*HDNVVIKKIFNFSXLITKVILFSSTL 318
           YD CC+      + + V +  F FS LI  V+ +S+ L
Sbjct: 346 YDTCCQGRATAIYIDKVSRFFFPFSFLILNVVYWSTFL 383


>DQ667186-1|ABG75738.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 205 YDPCCKLIIIT 237
           Y PCC L+I++
Sbjct: 249 YIPCCMLVIVS 259


>DQ667185-1|ABG75737.1|  447|Apis mellifera glutamate-gated chloride
           channel protein.
          Length = 447

 Score = 21.4 bits (43), Expect = 7.9
 Identities = 6/11 (54%), Positives = 9/11 (81%)
 Frame = +1

Query: 205 YDPCCKLIIIT 237
           Y PCC L+I++
Sbjct: 249 YIPCCMLVIVS 259


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 149,350
Number of Sequences: 438
Number of extensions: 2586
Number of successful extensions: 4
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 19804986
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)