BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_M22 (372 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q24154 Cluster: 60S ribosomal protein L29; n=12; Endopt... 95 4e-19 UniRef50_A2I402 Cluster: Ribosomal protein L29e-like protein; n=... 88 4e-17 UniRef50_Q84WM0 Cluster: 60S ribosomal protein L29-2; n=4; Arabi... 87 1e-16 UniRef50_P47914 Cluster: 60S ribosomal protein L29; n=251; Eukar... 86 2e-16 UniRef50_UPI0000F2DCEB Cluster: PREDICTED: similar to ribosomal ... 84 7e-16 UniRef50_Q92366 Cluster: 60S ribosomal protein L29; n=40; Eukary... 78 4e-14 UniRef50_Q4PEG3 Cluster: Putative uncharacterized protein; n=2; ... 76 2e-13 UniRef50_UPI0000F2CE67 Cluster: PREDICTED: similar to ribosomal ... 75 5e-13 UniRef50_Q7QPW0 Cluster: GLP_433_2266_2454; n=2; Eukaryota|Rep: ... 67 1e-10 UniRef50_Q0IFR8 Cluster: Putative uncharacterized protein; n=1; ... 65 3e-10 UniRef50_UPI0001552995 Cluster: PREDICTED: similar to ribosomal ... 64 8e-10 UniRef50_Q5KDL6 Cluster: Ribosomal protein L29.e, cytosolic, put... 60 1e-08 UniRef50_A6R574 Cluster: Predicted protein; n=1; Ajellomyces cap... 60 2e-08 UniRef50_Q4Y8Z0 Cluster: Putative uncharacterized protein; n=1; ... 59 2e-08 UniRef50_Q54TW3 Cluster: Ribosomal protein L29; n=1; Dictyosteli... 58 5e-08 UniRef50_Q9NAG9 Cluster: Putative uncharacterized protein; n=1; ... 57 1e-07 UniRef50_UPI000049A0F8 Cluster: 60S ribosomal protein L29; n=1; ... 55 4e-07 UniRef50_A7RTA1 Cluster: Predicted protein; n=1; Nematostella ve... 55 4e-07 UniRef50_UPI00001CA5CB Cluster: PREDICTED: similar to 60S riboso... 54 1e-06 UniRef50_A0CDP3 Cluster: Chromosome undetermined scaffold_17, wh... 53 2e-06 UniRef50_Q4Q178 Cluster: Ribosomal protein L29, putative; n=7; T... 50 1e-05 UniRef50_UPI0000D9C65B Cluster: PREDICTED: similar to 60S riboso... 46 2e-04 UniRef50_A5HW97 Cluster: Putative uncharacterized protein; n=2; ... 44 7e-04 UniRef50_A2DHA1 Cluster: Putative uncharacterized protein; n=2; ... 44 7e-04 UniRef50_UPI0000DC0BB6 Cluster: UPI0000DC0BB6 related cluster; n... 42 0.005 UniRef50_UPI0000E81F9E Cluster: PREDICTED: hypothetical protein,... 33 1.3 UniRef50_Q9ZWC3 Cluster: F21M11.3 protein; n=14; core eudicotyle... 33 2.2 UniRef50_A6SXL6 Cluster: Uncharacterized conserved protein; n=35... 31 5.0 UniRef50_A7TIL9 Cluster: Putative uncharacterized protein; n=1; ... 31 5.0 UniRef50_UPI0000519DFF Cluster: PREDICTED: similar to Caspase pr... 31 6.7 UniRef50_Q98RE9 Cluster: Putative uncharacterized protein MYPU_0... 31 6.7 UniRef50_Q76NU0 Cluster: Putative uncharacterized protein; n=2; ... 31 6.7 UniRef50_A2FZI3 Cluster: Putative uncharacterized protein; n=1; ... 31 6.7 UniRef50_Q7S9S3 Cluster: Putative uncharacterized protein NCU065... 31 6.7 UniRef50_Q0TXH9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 31 6.7 UniRef50_A7QR78 Cluster: Chromosome chr13 scaffold_149, whole ge... 31 8.8 UniRef50_Q5D943 Cluster: SJCHGC02809 protein; n=2; Schistosoma j... 31 8.8 UniRef50_Q4P9V1 Cluster: Putative uncharacterized protein; n=2; ... 31 8.8 UniRef50_A5DWT5 Cluster: Putative uncharacterized protein; n=1; ... 31 8.8 UniRef50_A5E572 Cluster: ATP-dependent RNA helicase DBP9; n=2; S... 31 8.8 >UniRef50_Q24154 Cluster: 60S ribosomal protein L29; n=12; Endopterygota|Rep: 60S ribosomal protein L29 - Drosophila melanogaster (Fruit fly) Length = 76 Score = 95.1 bits (226), Expect = 4e-19 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 MAKSKNHTNHNQN+KAHRNGIK+P + RHESTLGMD KFL NQR+ +KGNL Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNL 51 >UniRef50_A2I402 Cluster: Ribosomal protein L29e-like protein; n=2; Neoptera|Rep: Ribosomal protein L29e-like protein - Maconellicoccus hirsutus (hibiscus mealybug) Length = 90 Score = 88.2 bits (209), Expect = 4e-17 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 MAKSKNHTNHNQNRK HRNGIKKP++ R+ES LG+ KFL+NQRF KGNL Sbjct: 1 MAKSKNHTNHNQNRKDHRNGIKKPKRYRYESKLGVCQKFLKNQRFALKGNL 51 >UniRef50_Q84WM0 Cluster: 60S ribosomal protein L29-2; n=4; Arabidopsis thaliana|Rep: 60S ribosomal protein L29-2 - Arabidopsis thaliana (Mouse-ear cress) Length = 61 Score = 86.6 bits (205), Expect = 1e-16 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+ Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNV 51 >UniRef50_P47914 Cluster: 60S ribosomal protein L29; n=251; Eukaryota|Rep: 60S ribosomal protein L29 - Homo sapiens (Human) Length = 159 Score = 85.8 bits (203), Expect = 2e-16 Identities = 38/50 (76%), Positives = 41/50 (82%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGN 321 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK N Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHN 50 >UniRef50_UPI0000F2DCEB Cluster: PREDICTED: similar to ribosomal protein L29,; n=3; Monodelphis domestica|Rep: PREDICTED: similar to ribosomal protein L29, - Monodelphis domestica Length = 407 Score = 84.2 bits (199), Expect = 7e-16 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKK 315 MAKSKNHT HNQ+RK HRNGIKKPR R+ES G+DPKFLRN RF KK Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKK 48 >UniRef50_Q92366 Cluster: 60S ribosomal protein L29; n=40; Eukaryota|Rep: 60S ribosomal protein L29 - Schizosaccharomyces pombe (Fission yeast) Length = 61 Score = 78.2 bits (184), Expect = 4e-14 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 MAKSKNHTNHNQN+KAHRNGIK+P+K R++S D KF RNQ+F +G + Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPQKHRYDSLKYRDAKFRRNQKFANRGTV 51 >UniRef50_Q4PEG3 Cluster: Putative uncharacterized protein; n=2; Eukaryota|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 282 Score = 75.8 bits (178), Expect = 2e-13 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +1 Query: 169 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKG 318 +MAKSKN + HNQ RKAHRNGIKKP+ ++ S G+DPKF+RNQR+ K G Sbjct: 93 RMAKSKNSSQHNQVRKAHRNGIKKPKTNKYPSLRGVDPKFVRNQRYAKHG 142 >UniRef50_UPI0000F2CE67 Cluster: PREDICTED: similar to ribosomal protein L29/cell surface heparin binding protein HIP; n=4; Monodelphis domestica|Rep: PREDICTED: similar to ribosomal protein L29/cell surface heparin binding protein HIP - Monodelphis domestica Length = 252 Score = 74.5 bits (175), Expect = 5e-13 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKK 315 MAKSKNHT HNQ+RK HRNGIKKPR ++ES DPKFLRN F KK Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSLKYESLKEADPKFLRNTPFGKK 48 >UniRef50_Q7QPW0 Cluster: GLP_433_2266_2454; n=2; Eukaryota|Rep: GLP_433_2266_2454 - Giardia lamblia ATCC 50803 Length = 62 Score = 66.9 bits (156), Expect = 1e-10 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQR 303 MAK KNHT+ NQNRK HRNGIKKP+K+ + S GM PK+LRN R Sbjct: 1 MAKLKNHTSKNQNRKDHRNGIKKPKKSAYTSHKGMCPKYLRNLR 44 >UniRef50_Q0IFR8 Cluster: Putative uncharacterized protein; n=1; Aedes aegypti|Rep: Putative uncharacterized protein - Aedes aegypti (Yellowfever mosquito) Length = 97 Score = 65.3 bits (152), Expect = 3e-10 Identities = 38/72 (52%), Positives = 43/72 (59%), Gaps = 21/72 (29%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLG---------------------MDPKF 288 MAKSKNHTNHNQN+KAH+NGI KP++ R+EST G M KF Sbjct: 1 MAKSKNHTNHNQNQKAHKNGITKPKRQRNESTRGVSIISVACPLNRYPNVWPYLQMCQKF 60 Query: 289 LRNQRFCKKGNL 324 L N RF KKGNL Sbjct: 61 LHNLRFSKKGNL 72 >UniRef50_UPI0001552995 Cluster: PREDICTED: similar to ribosomal protein; n=2; Mus musculus|Rep: PREDICTED: similar to ribosomal protein - Mus musculus Length = 244 Score = 64.1 bits (149), Expect = 8e-10 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = +1 Query: 175 AKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKK 315 AKSKNH HNQ+ K +RNGIKKPR ++ + G+ PKFLRN F KK Sbjct: 47 AKSKNHITHNQSCKWYRNGIKKPRSPKNSTLPGLAPKFLRNMHFAKK 93 >UniRef50_Q5KDL6 Cluster: Ribosomal protein L29.e, cytosolic, putative; n=1; Filobasidiella neoformans|Rep: Ribosomal protein L29.e, cytosolic, putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 99 Score = 60.5 bits (140), Expect = 1e-08 Identities = 27/46 (58%), Positives = 34/46 (73%), Gaps = 2/46 (4%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK--FLRNQR 303 MAKSKNHT HNQ RKAHRN I++P+ ++ S G+DPK F RN + Sbjct: 1 MAKSKNHTAHNQTRKAHRNKIQRPKTNKYHSLKGVDPKVGFFRNAK 46 >UniRef50_A6R574 Cluster: Predicted protein; n=1; Ajellomyces capsulatus NAm1|Rep: Predicted protein - Ajellomyces capsulatus NAm1 Length = 176 Score = 59.7 bits (138), Expect = 2e-08 Identities = 26/54 (48%), Positives = 31/54 (57%) Frame = +1 Query: 163 LIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 L+ H+ H NRKAHRNGIKKP+ R+ S G DPKF RN R G + Sbjct: 109 LLPQTHQNGHSQHTLNRKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 162 >UniRef50_Q4Y8Z0 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 59 Score = 59.3 bits (137), Expect = 2e-08 Identities = 24/37 (64%), Positives = 29/37 (78%) Frame = +1 Query: 208 NRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKG 318 NRKAHRNGIKKP+ + S G+DPKF RNQ++C KG Sbjct: 1 NRKAHRNGIKKPKSHKFMSRKGLDPKFFRNQKYCLKG 37 >UniRef50_Q54TW3 Cluster: Ribosomal protein L29; n=1; Dictyostelium discoideum AX4|Rep: Ribosomal protein L29 - Dictyostelium discoideum AX4 Length = 93 Score = 58.0 bits (134), Expect = 5e-08 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKG 318 MAKSKNH+ H++NRK HRNGIKK + S+ G++ F RNQR+ + G Sbjct: 1 MAKSKNHSTHHKNRKDHRNGIKKAVVHKKTSSKGVELGFARNQRYARIG 49 >UniRef50_Q9NAG9 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 87 Score = 56.8 bits (131), Expect = 1e-07 Identities = 25/48 (52%), Positives = 33/48 (68%) Frame = +1 Query: 178 KSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGN 321 K +NHTNHN+N KAHRNGI KP+K S G +F+++ RF +K N Sbjct: 14 KPENHTNHNRNNKAHRNGITKPKKHIFLSIEGSRRQFIKSLRFFRKNN 61 >UniRef50_UPI000049A0F8 Cluster: 60S ribosomal protein L29; n=1; Entamoeba histolytica HM-1:IMSS|Rep: 60S ribosomal protein L29 - Entamoeba histolytica HM-1:IMSS Length = 64 Score = 55.2 bits (127), Expect = 4e-07 Identities = 23/48 (47%), Positives = 35/48 (72%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKK 315 M+K KN ++HNQ+ KAHRNG KP+K+ + ST GM+ + L+N + +K Sbjct: 1 MSKDKNRSSHNQSHKAHRNGFYKPKKSAYMSTKGMNVQVLKNTKAQRK 48 >UniRef50_A7RTA1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 94 Score = 55.2 bits (127), Expect = 4e-07 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = +1 Query: 214 KAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGN 321 K HRNGIKKPR R+ S G+DPKFLRN RF KK N Sbjct: 50 KWHRNGIKKPRTNRYPSLKGVDPKFLRNLRFSKKHN 85 >UniRef50_UPI00001CA5CB Cluster: PREDICTED: similar to 60S ribosomal protein L29 (P23); n=2; Rattus norvegicus|Rep: PREDICTED: similar to 60S ribosomal protein L29 (P23) - Rattus norvegicus Length = 105 Score = 53.6 bits (123), Expect = 1e-06 Identities = 24/39 (61%), Positives = 27/39 (69%) Frame = +1 Query: 181 SKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRN 297 SKNHT HNQ K HRNGIKKP R++S +DP LRN Sbjct: 5 SKNHTTHNQFHKWHRNGIKKPWSQRYKSLKVVDPNILRN 43 >UniRef50_A0CDP3 Cluster: Chromosome undetermined scaffold_17, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_17, whole genome shotgun sequence - Paramecium tetraurelia Length = 73 Score = 52.8 bits (121), Expect = 2e-06 Identities = 24/50 (48%), Positives = 33/50 (66%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGN 321 MAKSKN T+H+ RK HRNGIKK R+ + G + +F +N+RF K + Sbjct: 1 MAKSKNATSHHNARKHHRNGIKKLPNQRYRTLKGCNQRFAKNRRFAIKND 50 >UniRef50_Q4Q178 Cluster: Ribosomal protein L29, putative; n=7; Trypanosomatidae|Rep: Ribosomal protein L29, putative - Leishmania major Length = 70 Score = 50.4 bits (115), Expect = 1e-05 Identities = 28/51 (54%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTR-HESTLGMDPKFLRNQRFCKKGN 321 MAKSKNHTNHNQ+ K HRNGIK P H S G L N R +K N Sbjct: 1 MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNARRVRKHN 51 >UniRef50_UPI0000D9C65B Cluster: PREDICTED: similar to 60S ribosomal protein L29 (Cell surface heparin-binding protein HIP); n=1; Macaca mulatta|Rep: PREDICTED: similar to 60S ribosomal protein L29 (Cell surface heparin-binding protein HIP) - Macaca mulatta Length = 237 Score = 46.0 bits (104), Expect = 2e-04 Identities = 23/52 (44%), Positives = 33/52 (63%) Frame = +1 Query: 166 IKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGN 321 ++ S + T HNQ+RK +RNGIKK + +R+ ++PK LRN F KK N Sbjct: 26 VQTCPSPHTTTHNQSRKWNRNGIKKSQSSRYNFLKLVNPK-LRNMHFAKKYN 76 >UniRef50_A5HW97 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 167 Score = 44.4 bits (100), Expect = 7e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +1 Query: 178 KSKNHTNHNQNRKAHRNGIKKPR 246 KSKNHTNHNQN AHR GI KP+ Sbjct: 80 KSKNHTNHNQNNTAHRIGITKPK 102 >UniRef50_A2DHA1 Cluster: Putative uncharacterized protein; n=2; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 58 Score = 44.4 bits (100), Expect = 7e-04 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKG 318 MAK N + HN++ + HRNGI K + GM+ KFLRN R+ K G Sbjct: 1 MAKRSNTSAHNRSHQHHRNGIHKCVVKKLWFEKGMNAKFLRNARYAKAG 49 >UniRef50_UPI0000DC0BB6 Cluster: UPI0000DC0BB6 related cluster; n=1; Rattus norvegicus|Rep: UPI0000DC0BB6 UniRef100 entry - Rattus norvegicus Length = 142 Score = 41.5 bits (93), Expect = 0.005 Identities = 19/32 (59%), Positives = 24/32 (75%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHEST 267 MAKSKNHT H Q++K HRN IKKP+ + +T Sbjct: 17 MAKSKNHTTH-QSQKWHRNSIKKPKSFKGATT 47 >UniRef50_UPI0000E81F9E Cluster: PREDICTED: hypothetical protein, partial; n=3; Gallus gallus|Rep: PREDICTED: hypothetical protein, partial - Gallus gallus Length = 695 Score = 33.5 bits (73), Expect = 1.3 Identities = 14/38 (36%), Positives = 22/38 (57%) Frame = +1 Query: 160 KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLG 273 +L+K+ + +H +R R G +PRK +H STLG Sbjct: 220 ELVKLQRRHDHERDESSRSPARRGPGRPRKRKHCSTLG 257 >UniRef50_Q9ZWC3 Cluster: F21M11.3 protein; n=14; core eudicotyledons|Rep: F21M11.3 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 418 Score = 32.7 bits (71), Expect = 2.2 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 145 PLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 285 P+++ K AKSK T Q++K + N I + R S+ G DP+ Sbjct: 207 PVENLTQWKSAKSKGRTKQKQSQKENSNFIADQEEKRDSSSFGTDPQ 253 >UniRef50_A6SXL6 Cluster: Uncharacterized conserved protein; n=35; Betaproteobacteria|Rep: Uncharacterized conserved protein - Janthinobacterium sp. (strain Marseille) (Minibacterium massiliensis) Length = 305 Score = 31.5 bits (68), Expect = 5.0 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -1 Query: 333 GWLQVTLLAKPLIP*KFWIHAKGGFVPGLPWLFD 232 GWL VTL P F +H+ G FV PW + Sbjct: 233 GWLNVTLSVTTPSPDGFGLHSSGMFVHNPPWTLE 266 >UniRef50_A7TIL9 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 1055 Score = 31.5 bits (68), Expect = 5.0 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +1 Query: 178 KSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQ 300 K+ NH N N N K +KP T S + P+ L+ + Sbjct: 323 KNNNHNNTNSNSKNQNQSSQKPHSTHSVSHMHSKPRILKEE 363 >UniRef50_UPI0000519DFF Cluster: PREDICTED: similar to Caspase precursor (drICE); n=1; Apis mellifera|Rep: PREDICTED: similar to Caspase precursor (drICE) - Apis mellifera Length = 280 Score = 31.1 bits (67), Expect = 6.7 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +1 Query: 187 NHTNHNQNRKAHRNGIKKPRKTRHE--STLGMDPKFLRNQRFCK 312 NH NR++ RNG K +E STLG + K ++ +F K Sbjct: 50 NHEKFENNRESQRNGTNYDEKAINETFSTLGFEVKIYKDLKFNK 93 >UniRef50_Q98RE9 Cluster: Putative uncharacterized protein MYPU_0600; n=1; Mycoplasma pulmonis|Rep: Putative uncharacterized protein MYPU_0600 - Mycoplasma pulmonis Length = 306 Score = 31.1 bits (67), Expect = 6.7 Identities = 19/64 (29%), Positives = 26/64 (40%) Frame = -1 Query: 363 FSXSRPRELLGWLQVTLLAKPLIP*KFWIHAKGGFVPGLPWLFDTISVSFAVLVMICMIL 184 F R E WL + P +FWIH K F S+SF + ++IC + Sbjct: 189 FFKIRALEAFIWLTYLFIGLPSFSLRFWIHFKNQF-----------SISFEIFIIICFFI 237 Query: 183 *LCH 172 L H Sbjct: 238 LLLH 241 >UniRef50_Q76NU0 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum (Slime mold) Length = 760 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/40 (35%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 181 SKNHTNHNQNRKAHRNGIKKP-RKTRHESTLGMDPKFLRN 297 + N+ N+N+N+K++ NGI +R ++ L MD L N Sbjct: 45 NNNNNNNNKNKKSYHNGIADSYSNSREDTNLDMDKNNLAN 84 >UniRef50_A2FZI3 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 795 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +1 Query: 178 KSKNHTNHNQNRKAHRNGIKKPRKTRH--ESTLGMDPKFLRNQ 300 K+KNH NHN H + +K ++H + DPK +N+ Sbjct: 506 KNKNHENHNSKNSTHTSSNEKKNSSKHNEDDKNHEDPKSDKNK 548 >UniRef50_Q7S9S3 Cluster: Putative uncharacterized protein NCU06592.1; n=2; Sordariales|Rep: Putative uncharacterized protein NCU06592.1 - Neurospora crassa Length = 512 Score = 31.1 bits (67), Expect = 6.7 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +1 Query: 175 AKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 285 A + N+T NQN + +NG P K R ++L +D + Sbjct: 102 ATNANNTTSNQNNNSSQNGSLSPPKERERNSLTLDQR 138 >UniRef50_Q0TXH9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 120 Score = 31.1 bits (67), Expect = 6.7 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +1 Query: 235 KKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 +KP+ R+ S G DPKF RN R G + Sbjct: 77 RKPKTHRYPSLKGTDPKFRRNHRHALHGTM 106 >UniRef50_A7QR78 Cluster: Chromosome chr13 scaffold_149, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr13 scaffold_149, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 567 Score = 30.7 bits (66), Expect = 8.8 Identities = 19/46 (41%), Positives = 21/46 (45%) Frame = -3 Query: 349 PSRVAWLASGYPSCKTFDSLKILDPCQGWIRAWSSLAF*YHFCELC 212 P R+ L P F L IL PC G +R W L F F ELC Sbjct: 283 PPRIHDLGKVGPIGNNFAFL-ILLPCSGLLRVWLILLFSSMFAELC 327 >UniRef50_Q5D943 Cluster: SJCHGC02809 protein; n=2; Schistosoma japonicum|Rep: SJCHGC02809 protein - Schistosoma japonicum (Blood fluke) Length = 374 Score = 30.7 bits (66), Expect = 8.8 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +1 Query: 184 KNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQ 300 K+H HN NR+ R ++ P ++HE + P F+ N+ Sbjct: 234 KHHQYHNHNRQKRRKVLQVPH-SQHEFHMKHSPDFINNE 271 >UniRef50_Q4P9V1 Cluster: Putative uncharacterized protein; n=2; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 410 Score = 30.7 bits (66), Expect = 8.8 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -1 Query: 342 ELLGWLQVTLLAKPLIP*KFWIHAKGGFVP 253 E+L W + +AKP IP W KG F+P Sbjct: 321 EILAWAGIVFVAKPTIP--GWSIGKGAFIP 348 >UniRef50_A5DWT5 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 444 Score = 30.7 bits (66), Expect = 8.8 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +1 Query: 154 D*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEST 267 D L+++ N+T +N N + NG K+ + TR+ ST Sbjct: 257 DLPLLELENGGNYTTNNSNNNNNNNGSKRSQFTRNSST 294 >UniRef50_A5E572 Cluster: ATP-dependent RNA helicase DBP9; n=2; Saccharomycetales|Rep: ATP-dependent RNA helicase DBP9 - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 606 Score = 30.7 bits (66), Expect = 8.8 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 181 SKNHTNHNQNRKAHRNGIKKPRKTRHEST 267 + N+ NHN N K H+ +KK K + S+ Sbjct: 362 NNNNNNHNNNNKEHKEVLKKNEKNKKHSS 390 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 305,745,147 Number of Sequences: 1657284 Number of extensions: 5131184 Number of successful extensions: 15856 Number of sequences better than 10.0: 40 Number of HSP's better than 10.0 without gapping: 15110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15813 length of database: 575,637,011 effective HSP length: 91 effective length of database: 424,824,167 effective search space used: 13594373344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -