BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_M22 (372 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U40226-1|AAB01760.1| 76|Drosophila melanogaster L43 protein. 95 3e-20 AE013599-3176|AAF46708.1| 76|Drosophila melanogaster CG10071-P... 95 3e-20 AE013599-3175|AAM70864.1| 76|Drosophila melanogaster CG10071-P... 95 3e-20 AE013599-3174|AAM70863.1| 76|Drosophila melanogaster CG10071-P... 95 3e-20 AY075553-1|AAL68360.1| 56|Drosophila melanogaster RH58777p pro... 84 6e-17 AE013599-1923|AAF58230.1| 3257|Drosophila melanogaster CG12864-P... 29 2.6 AE013599-1922|AAO41391.1| 1633|Drosophila melanogaster CG12864-P... 29 2.6 AE014296-847|AAF47899.1| 604|Drosophila melanogaster CG15020-PA... 27 6.0 AF145661-1|AAD38636.1| 1189|Drosophila melanogaster BcDNA.GH1064... 27 7.9 AE014298-948|AAN09184.1| 3313|Drosophila melanogaster CG14438-PB... 27 7.9 AE014298-947|AAF46197.2| 3313|Drosophila melanogaster CG14438-PA... 27 7.9 AE014297-506|AAS65120.1| 777|Drosophila melanogaster CG31481-PB... 27 7.9 >U40226-1|AAB01760.1| 76|Drosophila melanogaster L43 protein. Length = 76 Score = 95.1 bits (226), Expect = 3e-20 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 MAKSKNHTNHNQN+KAHRNGIK+P + RHESTLGMD KFL NQR+ +KGNL Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNL 51 >AE013599-3176|AAF46708.1| 76|Drosophila melanogaster CG10071-PC, isoform C protein. Length = 76 Score = 95.1 bits (226), Expect = 3e-20 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 MAKSKNHTNHNQN+KAHRNGIK+P + RHESTLGMD KFL NQR+ +KGNL Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNL 51 >AE013599-3175|AAM70864.1| 76|Drosophila melanogaster CG10071-PB, isoform B protein. Length = 76 Score = 95.1 bits (226), Expect = 3e-20 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 MAKSKNHTNHNQN+KAHRNGIK+P + RHESTLGMD KFL NQR+ +KGNL Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNL 51 >AE013599-3174|AAM70863.1| 76|Drosophila melanogaster CG10071-PA, isoform A protein. Length = 76 Score = 95.1 bits (226), Expect = 3e-20 Identities = 41/51 (80%), Positives = 46/51 (90%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 MAKSKNHTNHNQN+KAHRNGIK+P + RHESTLGMD KFL NQR+ +KGNL Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNL 51 >AY075553-1|AAL68360.1| 56|Drosophila melanogaster RH58777p protein. Length = 56 Score = 83.8 bits (198), Expect = 6e-17 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRF 306 MAKSKNHTNHNQN+KAHRNGIK+P + RHESTLGMD KFL NQ + Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQHY 45 >AE013599-1923|AAF58230.1| 3257|Drosophila melanogaster CG12864-PA, isoform A protein. Length = 3257 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 142 FPLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTR 255 FP+QD ++ KM+K + H N +N K + K + R Sbjct: 2256 FPVQDAEIEKMSKGRGHQNAVKNTKTEQPKSKPKTEVR 2293 >AE013599-1922|AAO41391.1| 1633|Drosophila melanogaster CG12864-PB, isoform B protein. Length = 1633 Score = 28.7 bits (61), Expect = 2.6 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 142 FPLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTR 255 FP+QD ++ KM+K + H N +N K + K + R Sbjct: 632 FPVQDAEIEKMSKGRGHQNAVKNTKTEQPKSKPKTEVR 669 >AE014296-847|AAF47899.1| 604|Drosophila melanogaster CG15020-PA protein. Length = 604 Score = 27.5 bits (58), Expect = 6.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -3 Query: 229 HFCELCGFGYDLYDSLTLPF 170 HF C +GYD + ++T PF Sbjct: 313 HFKVTCEYGYDFWKTVTFPF 332 >AF145661-1|AAD38636.1| 1189|Drosophila melanogaster BcDNA.GH10646 protein. Length = 1189 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +2 Query: 110 RCVGIYSNDFIFLYRIEN 163 RCV ++ +D FLYRI N Sbjct: 1089 RCVAVFQDDGTFLYRIGN 1106 >AE014298-948|AAN09184.1| 3313|Drosophila melanogaster CG14438-PB, isoform B protein. Length = 3313 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 181 SKNHTNHNQNRKAHRNG 231 SKN+ NHNQN+ NG Sbjct: 544 SKNNNNHNQNQNVTANG 560 >AE014298-947|AAF46197.2| 3313|Drosophila melanogaster CG14438-PA, isoform A protein. Length = 3313 Score = 27.1 bits (57), Expect = 7.9 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = +1 Query: 181 SKNHTNHNQNRKAHRNG 231 SKN+ NHNQN+ NG Sbjct: 544 SKNNNNHNQNQNVTANG 560 >AE014297-506|AAS65120.1| 777|Drosophila melanogaster CG31481-PB, isoform B protein. Length = 777 Score = 27.1 bits (57), Expect = 7.9 Identities = 13/50 (26%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +1 Query: 169 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHEST--LGMDPKFLRNQRFCK 312 K K+ N+NQ + +NG+ + +T + +T L ++ +F N+ C+ Sbjct: 171 KKTSRKSSNNNNQGDNSIKNGLPRRLRTAYTNTQLLELEKEFHFNKYLCR 220 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,381,763 Number of Sequences: 53049 Number of extensions: 225764 Number of successful extensions: 848 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 848 length of database: 24,988,368 effective HSP length: 76 effective length of database: 20,956,644 effective search space used: 984962268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -