BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_M22 (372 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) simi... 87 4e-18 At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) simi... 87 5e-18 At1g04030.1 68414.m00390 expressed protein 33 0.080 At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, A... 32 0.14 At4g37950.1 68417.m05365 expressed protein 27 4.0 At5g56560.1 68418.m07058 F-box family protein contains F-box dom... 27 5.3 At4g01925.1 68417.m00256 DC1 domain-containing protein low simil... 26 7.0 At3g13760.1 68416.m01736 DC1 domain-containing protein contains ... 26 7.0 At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containi... 26 7.0 At3g25950.1 68416.m03234 hypothetical protein 26 9.2 >At3g06680.1 68416.m00788 60S ribosomal protein L29 (RPL29B) similar to 60S ribosomal protein L29 GB:P25886 from (Rattus norvegicus) Length = 83 Score = 87.0 bits (206), Expect = 4e-18 Identities = 37/52 (71%), Positives = 44/52 (84%) Frame = +1 Query: 169 KMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 +MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+ Sbjct: 22 EMAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNV 73 >At3g06700.1 68416.m00792 60S ribosomal protein L29 (RPL29A) similar to ribosomal protein L29 GI:7959366 [Panax ginseng] Length = 61 Score = 86.6 bits (205), Expect = 5e-18 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = +1 Query: 172 MAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPKFLRNQRFCKKGNL 324 MAKSKNHT HNQ+ KAH+NGIKKPR+ RH T GMDPKFLRNQR+ +K N+ Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNV 51 >At1g04030.1 68414.m00390 expressed protein Length = 418 Score = 32.7 bits (71), Expect = 0.080 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +1 Query: 145 PLQD*KLIKMAKSKNHTNHNQNRKAHRNGIKKPRKTRHESTLGMDPK 285 P+++ K AKSK T Q++K + N I + R S+ G DP+ Sbjct: 207 PVENLTQWKSAKSKGRTKQKQSQKENSNFIADQEEKRDSSSFGTDPQ 253 >At4g10220.1 68417.m01676 hypothetical protein IB1C3-1 protein, Arabidopsis thaliana, AJ011845 Length = 400 Score = 31.9 bits (69), Expect = 0.14 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +1 Query: 184 KNHTNHNQNRKAHRNGIKKPRKTRHESTLG 273 KNHT H++ R ++ G K RKT +T G Sbjct: 88 KNHTFHHKMRMSYSEGSKMKRKTHRNTTFG 117 >At4g37950.1 68417.m05365 expressed protein Length = 678 Score = 27.1 bits (57), Expect = 4.0 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +2 Query: 137 FIFLYRIENSSKWQSQ-RIIQIITKTAKLTEMVSKSQGRPGTNPPLAWIQNF*GIKGFAR 313 F+ L + WQ++ + Q T+ K+ M + + RPGT AW+ F G + R Sbjct: 399 FVGLALPGEAGSWQTENKGYQFWTRADKMG-MFTIANVRPGTYSLYAWVSGFIGDYKYVR 457 Query: 314 RVT 322 +T Sbjct: 458 DIT 460 >At5g56560.1 68418.m07058 F-box family protein contains F-box domain Pfam:PF00646 Length = 607 Score = 26.6 bits (56), Expect = 5.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -3 Query: 319 YPSCKTFDSLKILDPCQGWIRAWSSL 242 YP+C F SLK L+ C R W++L Sbjct: 475 YPACTVFSSLKYLELCTCSAR-WANL 499 >At4g01925.1 68417.m00256 DC1 domain-containing protein low similarity to UV-B light insensitive ULI3 [Arabidopsis thaliana] GI:17225050; contains Pfam profile PF03107: DC1 domain Length = 399 Score = 26.2 bits (55), Expect = 7.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -3 Query: 232 YHFCELCGFGYDLYDSLTLP 173 YH CE CGF DLY ++ P Sbjct: 65 YH-CETCGFDVDLYCAMYPP 83 >At3g13760.1 68416.m01736 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 652 Score = 26.2 bits (55), Expect = 7.0 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = -3 Query: 232 YHFCELCGFGYDLYDSLTLPF**VFNP 152 ++ C +CGF DL +LTLP + NP Sbjct: 182 FYRCLICGFCLDLSCALTLPPLTIANP 208 >At1g62720.1 68414.m07079 pentatricopeptide (PPR) repeat-containing protein contains multiple PPR repeats Pfam Profile: PF01535 Length = 426 Score = 26.2 bits (55), Expect = 7.0 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 232 YHFCELCGFGYDLY 191 +H E+CG G+DLY Sbjct: 33 FHHMEVCGIGHDLY 46 >At3g25950.1 68416.m03234 hypothetical protein Length = 251 Score = 25.8 bits (54), Expect = 9.2 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 273 AKGGFVPGLPWLFDTISVSFAVLVMICMIL 184 A G VP WL + + FA+LV I +L Sbjct: 205 AADGVVPRWAWLSWLVVIGFAILVSILWVL 234 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,682,039 Number of Sequences: 28952 Number of extensions: 113506 Number of successful extensions: 328 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 326 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 497853200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -