BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= fe100P02_F_M14 (378 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 24 0.52 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 24 0.52 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 21 3.6 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 3.6 U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 21 6.4 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.2 bits (50), Expect = 0.52 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = -2 Query: 245 FRATHTLRMLPYLENIFXISYLDALVPKLPTYTLQERSHS 126 FR+ T +M P+++ +F LV + P Y + +S Sbjct: 333 FRSPQTHKMAPWVKRVFIHILPRLLVMRRPQYKFETNRYS 372 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 24.2 bits (50), Expect = 0.52 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = -2 Query: 245 FRATHTLRMLPYLENIFXISYLDALVPKLPTYTLQERSHS 126 FR+ T +M P+++ +F LV + P Y + +S Sbjct: 333 FRSPQTHKMAPWVKRVFIHILPRLLVMRRPQYKFETNRYS 372 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 21.4 bits (43), Expect = 3.6 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +2 Query: 89 TLFNSKLRCLATENGIFLAKCTWATWVLMRLNMKXKKY 202 ++ NS L+ + A CT+AT L + +KY Sbjct: 30 SMLNSHLKSHSNVYQYRCANCTYATKYCHSLKLHLRKY 67 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 3.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +2 Query: 143 AKCTWATWVLMRLNMK 190 +KCTW R+N+K Sbjct: 68 SKCTWTITSYHRINLK 83 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 20.6 bits (41), Expect = 6.4 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 179 LNMKXKKYFLNTVTYVTYG*LEIRP 253 ++ K + Y N +T YG L IRP Sbjct: 58 IDYKQRVYDKNGMTGDAYGGLNIRP 82 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,885 Number of Sequences: 438 Number of extensions: 2048 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 9176370 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -